FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KE5145, 100 aa
  1>>>pF1KE5145 100 - 100 aa - 100 aa
Library: /omim/omim.rfq.tfa
  60827320 residues in 85289 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 4.6784+/-0.000244; mu= 14.0656+/- 0.015
 mean_var=65.1044+/-12.841, 0's: 0 Z-trim(122.0): 2  B-trim: 0 in 0/54
 Lambda= 0.158953
 statistics sampled from 39380 (39382) to 39380 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.83), E-opt: 0.2 (0.462), width:  16
 Scan time:  4.700

The best scores are:                                      opt bits E(85289)
NP_954642 (OMIM: 112260) osteocalcin preproprotein ( 100)  684 163.9 3.8e-41


>>NP_954642 (OMIM: 112260) osteocalcin preproprotein [Ho  (100 aa)
 initn: 684 init1: 684 opt: 684  Z-score: 859.6  bits: 163.9 E(85289): 3.8e-41
Smith-Waterman score: 684; 100.0% identity (100.0% similar) in 100 aa overlap (1-100:1-100)

               10        20        30        40        50        60
pF1KE5 MRALTLLALLALAALCIAGQAGAKPSGAESSKGAAFVSKQEGSEVVKRPRRYLYQWLGAP
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
NP_954 MRALTLLALLALAALCIAGQAGAKPSGAESSKGAAFVSKQEGSEVVKRPRRYLYQWLGAP
               10        20        30        40        50        60

               70        80        90       100
pF1KE5 VPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV
       ::::::::::::::::::::::::::::::::::::::::
NP_954 VPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV
               70        80        90       100




100 residues in 1 query   sequences
60827320 residues in 85289 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Tue Nov  8 07:20:30 2016 done: Tue Nov  8 07:20:31 2016
 Total Scan time:  4.700 Total Display time: -0.020

Function used was FASTA [36.3.4 Apr, 2011]