FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE6546, 106 aa 1>>>pF1KE6546 106 - 106 aa - 106 aa Library: /omim/omim.rfq.tfa 60827320 residues in 85289 sequences Statistics: Expectation_n fit: rho(ln(x))= 4.8266+/-0.000274; mu= 13.0532+/- 0.017 mean_var=65.0224+/-13.338, 0's: 0 Z-trim(120.9): 4 B-trim: 1120 in 1/53 Lambda= 0.159053 statistics sampled from 36787 (36791) to 36787 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.811), E-opt: 0.2 (0.431), width: 16 Scan time: 3.600 The best scores are: opt bits E(85289) NP_004543 (OMIM: 603847) NADH dehydrogenase [ubiqu ( 106) 762 182.2 1.4e-46 NP_001171908 (OMIM: 603847) NADH dehydrogenase [ub ( 106) 762 182.2 1.4e-46 >>NP_004543 (OMIM: 603847) NADH dehydrogenase [ubiquinon (106 aa) initn: 762 init1: 762 opt: 762 Z-score: 957.4 bits: 182.2 E(85289): 1.4e-46 Smith-Waterman score: 762; 100.0% identity (100.0% similar) in 106 aa overlap (1-106:1-106) 10 20 30 40 50 60 pF1KE6 MPFLDIQKRFGLNIDRWLTIQSGEQPYKMAGRCHAFEKEWIECAHGIGYTRAEKECKIEY :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_004 MPFLDIQKRFGLNIDRWLTIQSGEQPYKMAGRCHAFEKEWIECAHGIGYTRAEKECKIEY 10 20 30 40 50 60 70 80 90 100 pF1KE6 DDFVECLLRQKTMRRAGTIRKQRDKLIKEGKYTPPPHHIGKGEPRP :::::::::::::::::::::::::::::::::::::::::::::: NP_004 DDFVECLLRQKTMRRAGTIRKQRDKLIKEGKYTPPPHHIGKGEPRP 70 80 90 100 >>NP_001171908 (OMIM: 603847) NADH dehydrogenase [ubiqui (106 aa) initn: 762 init1: 762 opt: 762 Z-score: 957.4 bits: 182.2 E(85289): 1.4e-46 Smith-Waterman score: 762; 100.0% identity (100.0% similar) in 106 aa overlap (1-106:1-106) 10 20 30 40 50 60 pF1KE6 MPFLDIQKRFGLNIDRWLTIQSGEQPYKMAGRCHAFEKEWIECAHGIGYTRAEKECKIEY :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_001 MPFLDIQKRFGLNIDRWLTIQSGEQPYKMAGRCHAFEKEWIECAHGIGYTRAEKECKIEY 10 20 30 40 50 60 70 80 90 100 pF1KE6 DDFVECLLRQKTMRRAGTIRKQRDKLIKEGKYTPPPHHIGKGEPRP :::::::::::::::::::::::::::::::::::::::::::::: NP_001 DDFVECLLRQKTMRRAGTIRKQRDKLIKEGKYTPPPHHIGKGEPRP 70 80 90 100 106 residues in 1 query sequences 60827320 residues in 85289 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Tue Nov 8 14:17:31 2016 done: Tue Nov 8 14:17:32 2016 Total Scan time: 3.600 Total Display time: -0.030 Function used was FASTA [36.3.4 Apr, 2011]