FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE5161, 134 aa 1>>>pF1KE5161 134 - 134 aa - 134 aa Library: /omim/omim.rfq.tfa 60827320 residues in 85289 sequences Statistics: Expectation_n fit: rho(ln(x))= 5.1888+/-0.000257; mu= 12.9957+/- 0.016 mean_var=74.9148+/-15.193, 0's: 0 Z-trim(121.9): 12 B-trim: 1381 in 2/56 Lambda= 0.148180 statistics sampled from 39186 (39210) to 39186 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.823), E-opt: 0.2 (0.46), width: 16 Scan time: 5.140 The best scores are: opt bits E(85289) NP_002512 (OMIM: 600295) natriuretic peptides B pr ( 134) 895 199.2 1.7e-51 >>NP_002512 (OMIM: 600295) natriuretic peptides B prepro (134 aa) initn: 895 init1: 895 opt: 895 Z-score: 1045.7 bits: 199.2 E(85289): 1.7e-51 Smith-Waterman score: 895; 100.0% identity (100.0% similar) in 134 aa overlap (1-134:1-134) 10 20 30 40 50 60 pF1KE5 MDPQTAPSRALLLLLFLHLAFLGGRSHPLGSPGSASDLETSGLQEQRNHLQGKLSELQVE :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_002 MDPQTAPSRALLLLLFLHLAFLGGRSHPLGSPGSASDLETSGLQEQRNHLQGKLSELQVE 10 20 30 40 50 60 70 80 90 100 110 120 pF1KE5 QTSLEPLQESPRPTGVWKSREVATEGIRGHRKMVLYTLRAPRSPKMVQGSGCFGRKMDRI :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_002 QTSLEPLQESPRPTGVWKSREVATEGIRGHRKMVLYTLRAPRSPKMVQGSGCFGRKMDRI 70 80 90 100 110 120 130 pF1KE5 SSSSGLGCKVLRRH :::::::::::::: NP_002 SSSSGLGCKVLRRH 130 134 residues in 1 query sequences 60827320 residues in 85289 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Mon Nov 7 22:10:35 2016 done: Mon Nov 7 22:10:36 2016 Total Scan time: 5.140 Total Display time: -0.040 Function used was FASTA [36.3.4 Apr, 2011]