FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE5161, 134 aa 1>>>pF1KE5161 134 - 134 aa - 134 aa Library: human.CCDS.faa 18511270 residues in 32554 sequences Statistics: Expectation_n fit: rho(ln(x))= 5.2409+/-0.00054; mu= 12.5951+/- 0.033 mean_var=71.7776+/-14.211, 0's: 0 Z-trim(114.9): 8 B-trim: 312 in 1/51 Lambda= 0.151384 statistics sampled from 15418 (15426) to 15418 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.827), E-opt: 0.2 (0.474), width: 16 Scan time: 1.960 The best scores are: opt bits E(32554) CCDS140.1 NPPB gene_id:4879|Hs108|chr1 ( 134) 895 203.2 4.1e-53 >>CCDS140.1 NPPB gene_id:4879|Hs108|chr1 (134 aa) initn: 895 init1: 895 opt: 895 Z-score: 1067.1 bits: 203.2 E(32554): 4.1e-53 Smith-Waterman score: 895; 100.0% identity (100.0% similar) in 134 aa overlap (1-134:1-134) 10 20 30 40 50 60 pF1KE5 MDPQTAPSRALLLLLFLHLAFLGGRSHPLGSPGSASDLETSGLQEQRNHLQGKLSELQVE :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS14 MDPQTAPSRALLLLLFLHLAFLGGRSHPLGSPGSASDLETSGLQEQRNHLQGKLSELQVE 10 20 30 40 50 60 70 80 90 100 110 120 pF1KE5 QTSLEPLQESPRPTGVWKSREVATEGIRGHRKMVLYTLRAPRSPKMVQGSGCFGRKMDRI :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS14 QTSLEPLQESPRPTGVWKSREVATEGIRGHRKMVLYTLRAPRSPKMVQGSGCFGRKMDRI 70 80 90 100 110 120 130 pF1KE5 SSSSGLGCKVLRRH :::::::::::::: CCDS14 SSSSGLGCKVLRRH 130 134 residues in 1 query sequences 18511270 residues in 32554 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Mon Nov 7 22:10:34 2016 done: Mon Nov 7 22:10:35 2016 Total Scan time: 1.960 Total Display time: -0.030 Function used was FASTA [36.3.4 Apr, 2011]