FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE6596, 64 aa 1>>>pF1KE6596 64 - 64 aa - 64 aa Library: /omim/omim.rfq.tfa 60827320 residues in 85289 sequences Statistics: Expectation_n fit: rho(ln(x))= 4.2110+/-0.000261; mu= 11.3674+/- 0.016 mean_var=41.7775+/- 8.240, 0's: 0 Z-trim(118.7): 11 B-trim: 0 in 0/54 Lambda= 0.198428 statistics sampled from 31918 (31929) to 31918 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.783), E-opt: 0.2 (0.374), width: 16 Scan time: 2.870 The best scores are: opt bits E(85289) NP_001304747 (OMIM: 611459) sodium/bile acid cotra ( 64) 402 121.1 1.3e-28 XP_016864180 (OMIM: 611459) PREDICTED: sodium/bile ( 149) 394 119.0 1.2e-27 NP_115504 (OMIM: 611459) sodium/bile acid cotransp ( 159) 394 119.0 1.3e-27 XP_016864179 (OMIM: 611459) PREDICTED: sodium/bile ( 163) 394 119.0 1.3e-27 XP_016864178 (OMIM: 611459) PREDICTED: sodium/bile ( 180) 394 119.0 1.5e-27 NP_001304745 (OMIM: 611459) sodium/bile acid cotra ( 327) 394 119.2 2.4e-27 NP_001025169 (OMIM: 611459) sodium/bile acid cotra ( 340) 394 119.2 2.5e-27 XP_011530613 (OMIM: 611459) PREDICTED: sodium/bile ( 345) 394 119.2 2.5e-27 XP_016864181 (OMIM: 611459) PREDICTED: sodium/bile ( 85) 388 117.1 2.6e-27 NP_001304746 (OMIM: 611459) sodium/bile acid cotra ( 85) 388 117.1 2.6e-27 NP_001287771 (OMIM: 611459) sodium/bile acid cotra ( 358) 394 119.2 2.6e-27 >>NP_001304747 (OMIM: 611459) sodium/bile acid cotranspo (64 aa) initn: 402 init1: 402 opt: 402 Z-score: 634.9 bits: 121.1 E(85289): 1.3e-28 Smith-Waterman score: 402; 100.0% identity (100.0% similar) in 64 aa overlap (1-64:1-64) 10 20 30 40 50 60 pF1KE6 MRLLERMRKDWFMVGIVLAIAGAKLEPSIGVNGGPLKPEITVSYIAVATIFFNSGLSLKT :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_001 MRLLERMRKDWFMVGIVLAIAGAKLEPSIGVNGGPLKPEITVSYIAVATIFFNSGLSLKT 10 20 30 40 50 60 pF1KE6 ELLT :::: NP_001 ELLT >>XP_016864180 (OMIM: 611459) PREDICTED: sodium/bile aci (149 aa) initn: 394 init1: 394 opt: 394 Z-score: 617.0 bits: 119.0 E(85289): 1.2e-27 Smith-Waterman score: 394; 98.4% identity (98.4% similar) in 64 aa overlap (1-64:1-64) 10 20 30 40 50 60 pF1KE6 MRLLERMRKDWFMVGIVLAIAGAKLEPSIGVNGGPLKPEITVSYIAVATIFFNSGLSLKT :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: XP_016 MRLLERMRKDWFMVGIVLAIAGAKLEPSIGVNGGPLKPEITVSYIAVATIFFNSGLSLKT 10 20 30 40 50 60 pF1KE6 ELLT : :: XP_016 EELTSALVHLKLHLFIQIFTLAFFPATIWLFLQLLSITPINEWLLKGLQTVGCMPPPVSS 70 80 90 100 110 120 >>NP_115504 (OMIM: 611459) sodium/bile acid cotransporte (159 aa) initn: 394 init1: 394 opt: 394 Z-score: 616.6 bits: 119.0 E(85289): 1.3e-27 Smith-Waterman score: 394; 98.4% identity (98.4% similar) in 64 aa overlap (1-64:1-64) 10 20 30 40 50 60 pF1KE6 MRLLERMRKDWFMVGIVLAIAGAKLEPSIGVNGGPLKPEITVSYIAVATIFFNSGLSLKT :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_115 MRLLERMRKDWFMVGIVLAIAGAKLEPSIGVNGGPLKPEITVSYIAVATIFFNSGLSLKT 10 20 30 40 50 60 pF1KE6 ELLT : :: NP_115 EELTSALVHLKLHLFIQIFTLAFFPATIWLFLQLLSITPINEWLLKGLQTVGCMPPPVSS 70 80 90 100 110 120 >>XP_016864179 (OMIM: 611459) PREDICTED: sodium/bile aci (163 aa) initn: 394 init1: 394 opt: 394 Z-score: 616.5 bits: 119.0 E(85289): 1.3e-27 Smith-Waterman score: 394; 98.4% identity (98.4% similar) in 64 aa overlap (1-64:1-64) 10 20 30 40 50 60 pF1KE6 MRLLERMRKDWFMVGIVLAIAGAKLEPSIGVNGGPLKPEITVSYIAVATIFFNSGLSLKT :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: XP_016 MRLLERMRKDWFMVGIVLAIAGAKLEPSIGVNGGPLKPEITVSYIAVATIFFNSGLSLKT 10 20 30 40 50 60 pF1KE6 ELLT : :: XP_016 EELTSALVHLKLHLFIQIFTLAFFPATIWLFLQLLSITPINEWLLKGLQTVGCMPPPVSS 70 80 90 100 110 120 >>XP_016864178 (OMIM: 611459) PREDICTED: sodium/bile aci (180 aa) initn: 394 init1: 394 opt: 394 Z-score: 615.8 bits: 119.0 E(85289): 1.5e-27 Smith-Waterman score: 394; 98.4% identity (98.4% similar) in 64 aa overlap (1-64:1-64) 10 20 30 40 50 60 pF1KE6 MRLLERMRKDWFMVGIVLAIAGAKLEPSIGVNGGPLKPEITVSYIAVATIFFNSGLSLKT :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: XP_016 MRLLERMRKDWFMVGIVLAIAGAKLEPSIGVNGGPLKPEITVSYIAVATIFFNSGLSLKT 10 20 30 40 50 60 pF1KE6 ELLT : :: XP_016 EELTSALVHLKLHLFIQIFTLAFFPATIWLFLQLLSITPINEWLLKGLQTVGCMPPPVSS 70 80 90 100 110 120 >>NP_001304745 (OMIM: 611459) sodium/bile acid cotranspo (327 aa) initn: 394 init1: 394 opt: 394 Z-score: 611.9 bits: 119.2 E(85289): 2.4e-27 Smith-Waterman score: 394; 98.4% identity (98.4% similar) in 64 aa overlap (1-64:1-64) 10 20 30 40 50 60 pF1KE6 MRLLERMRKDWFMVGIVLAIAGAKLEPSIGVNGGPLKPEITVSYIAVATIFFNSGLSLKT :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_001 MRLLERMRKDWFMVGIVLAIAGAKLEPSIGVNGGPLKPEITVSYIAVATIFFNSGLSLKT 10 20 30 40 50 60 pF1KE6 ELLT : :: NP_001 EELTSALVHLKLHLFIQIFTLAFFPATIWLFLQLLSITPINEWLLKGLQTVGCMPPPVSS 70 80 90 100 110 120 >>NP_001025169 (OMIM: 611459) sodium/bile acid cotranspo (340 aa) initn: 394 init1: 394 opt: 394 Z-score: 611.7 bits: 119.2 E(85289): 2.5e-27 Smith-Waterman score: 394; 98.4% identity (98.4% similar) in 64 aa overlap (1-64:1-64) 10 20 30 40 50 60 pF1KE6 MRLLERMRKDWFMVGIVLAIAGAKLEPSIGVNGGPLKPEITVSYIAVATIFFNSGLSLKT :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_001 MRLLERMRKDWFMVGIVLAIAGAKLEPSIGVNGGPLKPEITVSYIAVATIFFNSGLSLKT 10 20 30 40 50 60 pF1KE6 ELLT : :: NP_001 EELTSALVHLKLHLFIQIFTLAFFPATIWLFLQLLSITPINEWLLKGLQTVGCMPPPVSS 70 80 90 100 110 120 >>XP_011530613 (OMIM: 611459) PREDICTED: sodium/bile aci (345 aa) initn: 394 init1: 394 opt: 394 Z-score: 611.6 bits: 119.2 E(85289): 2.5e-27 Smith-Waterman score: 394; 98.4% identity (98.4% similar) in 64 aa overlap (1-64:1-64) 10 20 30 40 50 60 pF1KE6 MRLLERMRKDWFMVGIVLAIAGAKLEPSIGVNGGPLKPEITVSYIAVATIFFNSGLSLKT :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: XP_011 MRLLERMRKDWFMVGIVLAIAGAKLEPSIGVNGGPLKPEITVSYIAVATIFFNSGLSLKT 10 20 30 40 50 60 pF1KE6 ELLT : :: XP_011 EELTSALVHLKLHLFIQIFTLAFFPATIWLFLQLLSITPINEWLLKGLQTVGCMPPPVSS 70 80 90 100 110 120 >>XP_016864181 (OMIM: 611459) PREDICTED: sodium/bile aci (85 aa) initn: 388 init1: 388 opt: 388 Z-score: 611.4 bits: 117.1 E(85289): 2.6e-27 Smith-Waterman score: 388; 98.4% identity (100.0% similar) in 62 aa overlap (1-62:1-62) 10 20 30 40 50 60 pF1KE6 MRLLERMRKDWFMVGIVLAIAGAKLEPSIGVNGGPLKPEITVSYIAVATIFFNSGLSLKT :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: XP_016 MRLLERMRKDWFMVGIVLAIAGAKLEPSIGVNGGPLKPEITVSYIAVATIFFNSGLSLKT 10 20 30 40 50 60 pF1KE6 ELLT :. XP_016 EFADSRLHASACVFCSDFNQGSWWK 70 80 >>NP_001304746 (OMIM: 611459) sodium/bile acid cotranspo (85 aa) initn: 388 init1: 388 opt: 388 Z-score: 611.4 bits: 117.1 E(85289): 2.6e-27 Smith-Waterman score: 388; 98.4% identity (100.0% similar) in 62 aa overlap (1-62:1-62) 10 20 30 40 50 60 pF1KE6 MRLLERMRKDWFMVGIVLAIAGAKLEPSIGVNGGPLKPEITVSYIAVATIFFNSGLSLKT :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_001 MRLLERMRKDWFMVGIVLAIAGAKLEPSIGVNGGPLKPEITVSYIAVATIFFNSGLSLKT 10 20 30 40 50 60 pF1KE6 ELLT :. NP_001 EFADSRLHASACVFCSDFNQGSWWK 70 80 64 residues in 1 query sequences 60827320 residues in 85289 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Tue Nov 8 14:40:08 2016 done: Tue Nov 8 14:40:09 2016 Total Scan time: 2.870 Total Display time: -0.020 Function used was FASTA [36.3.4 Apr, 2011]