FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE6504, 179 aa 1>>>pF1KE6504 179 - 179 aa - 179 aa Library: /omim/omim.rfq.tfa 60827320 residues in 85289 sequences Statistics: Expectation_n fit: rho(ln(x))= 9.4939+/-0.000343; mu= -1.7773+/- 0.022 mean_var=400.5653+/-82.326, 0's: 0 Z-trim(126.8): 6 B-trim: 1006 in 1/61 Lambda= 0.064082 statistics sampled from 53482 (53497) to 53482 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.869), E-opt: 0.2 (0.627), width: 16 Scan time: 4.280 The best scores are: opt bits E(85289) NP_619646 (OMIM: 234050,609188) M-phase-specific P ( 179) 1335 135.5 4.4e-32 >>NP_619646 (OMIM: 234050,609188) M-phase-specific PLK1- (179 aa) initn: 1335 init1: 1335 opt: 1335 Z-score: 696.9 bits: 135.5 E(85289): 4.4e-32 Smith-Waterman score: 1335; 100.0% identity (100.0% similar) in 179 aa overlap (1-179:1-179) 10 20 30 40 50 60 pF1KE6 MQRQNFRPPTPPYPGPGGGGWGSGSSFRGTPGGGGPRPPSPRDGYGSPHHTPPYGPRSRP :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_619 MQRQNFRPPTPPYPGPGGGGWGSGSSFRGTPGGGGPRPPSPRDGYGSPHHTPPYGPRSRP 10 20 30 40 50 60 70 80 90 100 110 120 pF1KE6 YGSSHSPRHGGSFPGGRFGSPSPGGYPGSYSRSPAGSQQQFGYSPGQQQTHPQGSPRTST :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_619 YGSSHSPRHGGSFPGGRFGSPSPGGYPGSYSRSPAGSQQQFGYSPGQQQTHPQGSPRTST 70 80 90 100 110 120 130 140 150 160 170 pF1KE6 PFGSGRVREKRMSNELENYFKPSMLEDPWAGLEPVSVVDISQQYSNTQTFTGKKGRYFC ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_619 PFGSGRVREKRMSNELENYFKPSMLEDPWAGLEPVSVVDISQQYSNTQTFTGKKGRYFC 130 140 150 160 170 179 residues in 1 query sequences 60827320 residues in 85289 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Tue Nov 8 13:54:58 2016 done: Tue Nov 8 13:54:59 2016 Total Scan time: 4.280 Total Display time: -0.020 Function used was FASTA [36.3.4 Apr, 2011]