FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE6196, 100 aa 1>>>pF1KE6196 100 - 100 aa - 100 aa Library: human.CCDS.faa 18511270 residues in 32554 sequences Statistics: Expectation_n fit: rho(ln(x))= 5.4259+/-0.000571; mu= 8.3178+/- 0.034 mean_var=49.8619+/-10.024, 0's: 0 Z-trim(110.8): 4 B-trim: 0 in 0/49 Lambda= 0.181631 statistics sampled from 11859 (11861) to 11859 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.753), E-opt: 0.2 (0.364), width: 16 Scan time: 1.160 The best scores are: opt bits E(32554) CCDS54534.1 ATP5L2 gene_id:267020|Hs108|chr22 ( 100) 631 172.2 4.7e-44 CCDS8397.1 ATP5L gene_id:10632|Hs108|chr11 ( 103) 558 153.1 2.8e-38 >>CCDS54534.1 ATP5L2 gene_id:267020|Hs108|chr22 (100 aa) initn: 631 init1: 631 opt: 631 Z-score: 904.3 bits: 172.2 E(32554): 4.7e-44 Smith-Waterman score: 631; 100.0% identity (100.0% similar) in 100 aa overlap (1-100:1-100) 10 20 30 40 50 60 pF1KE6 MAPFVRNLVEKTPALVNAAVTYLKPRLAAFWYYTTVELVPPTPAEIPRAIQSLKKIVSSA :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS54 MAPFVRNLVEKTPALVNAAVTYLKPRLAAFWYYTTVELVPPTPAEIPRAIQSLKKIVSSA 10 20 30 40 50 60 70 80 90 100 pF1KE6 QTGSFKQLTVKEALLNGLVATEVSTWFYVREITGKRGIIG :::::::::::::::::::::::::::::::::::::::: CCDS54 QTGSFKQLTVKEALLNGLVATEVSTWFYVREITGKRGIIG 70 80 90 100 >>CCDS8397.1 ATP5L gene_id:10632|Hs108|chr11 (103 aa) initn: 558 init1: 558 opt: 558 Z-score: 800.7 bits: 153.1 E(32554): 2.8e-38 Smith-Waterman score: 558; 89.0% identity (93.0% similar) in 100 aa overlap (1-100:1-100) 10 20 30 40 50 60 pF1KE6 MAPFVRNLVEKTPALVNAAVTYLKPRLAAFWYYTTVELVPPTPAEIPRAIQSLKKIVSSA :: ::::::::::::::::::: :::::.::::. ::::::::::::::::::::::.:: CCDS83 MAQFVRNLVEKTPALVNAAVTYSKPRLATFWYYAKVELVPPTPAEIPRAIQSLKKIVNSA 10 20 30 40 50 60 70 80 90 100 pF1KE6 QTGSFKQLTVKEALLNGLVATEVSTWFYVREITGKRGIIG :::::::::::::.::::::::: :::: :: ::::::: CCDS83 QTGSFKQLTVKEAVLNGLVATEVLMWFYVGEIIGKRGIIGYDV 70 80 90 100 100 residues in 1 query sequences 18511270 residues in 32554 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Tue Nov 8 10:15:36 2016 done: Tue Nov 8 10:15:36 2016 Total Scan time: 1.160 Total Display time: -0.030 Function used was FASTA [36.3.4 Apr, 2011]