FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE5085, 61 aa 1>>>pF1KE5085 61 - 61 aa - 61 aa Library: /omim/omim.rfq.tfa 60827320 residues in 85289 sequences Statistics: Expectation_n fit: rho(ln(x))= 4.4959+/-0.000242; mu= 10.0399+/- 0.015 mean_var=42.1249+/- 8.402, 0's: 0 Z-trim(120.8): 1 B-trim: 1302 in 1/54 Lambda= 0.197608 statistics sampled from 36488 (36489) to 36488 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.811), E-opt: 0.2 (0.428), width: 16 Scan time: 3.650 The best scores are: opt bits E(85289) NP_001794 (OMIM: 114280) CAMPATH-1 antigen precurs ( 61) 380 114.1 1.4e-26 >>NP_001794 (OMIM: 114280) CAMPATH-1 antigen precursor [ (61 aa) initn: 380 init1: 380 opt: 380 Z-score: 598.2 bits: 114.1 E(85289): 1.4e-26 Smith-Waterman score: 380; 100.0% identity (100.0% similar) in 61 aa overlap (1-61:1-61) 10 20 30 40 50 60 pF1KE5 MKRFLFLLLTISLLVMVQIQTGLSGQNDTSQTSSPSASSNISGGIFLFFVANAIIHLFCF :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_001 MKRFLFLLLTISLLVMVQIQTGLSGQNDTSQTSSPSASSNISGGIFLFFVANAIIHLFCF 10 20 30 40 50 60 pF1KE5 S : NP_001 S 61 residues in 1 query sequences 60827320 residues in 85289 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Tue Nov 8 04:53:00 2016 done: Tue Nov 8 04:53:00 2016 Total Scan time: 3.650 Total Display time: -0.020 Function used was FASTA [36.3.4 Apr, 2011]