FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KE5085, 61 aa
  1>>>pF1KE5085 61 - 61 aa - 61 aa
Library: human.CCDS.faa
  18511270 residues in 32554 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 4.3908+/-0.000465; mu= 10.6420+/- 0.028
 mean_var=42.8473+/- 8.433, 0's: 0 Z-trim(113.6): 3  B-trim: 0 in 0/53
 Lambda= 0.195935
 statistics sampled from 14206 (14207) to 14206 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.812), E-opt: 0.2 (0.436), width:  16
 Scan time:  1.180

The best scores are:                                      opt bits E(32554)
CCDS30647.1 CD52 gene_id:1043|Hs108|chr1           (  61)  380 113.2   1e-26


>>CCDS30647.1 CD52 gene_id:1043|Hs108|chr1                (61 aa)
 initn: 380 init1: 380 opt: 380  Z-score: 593.2  bits: 113.2 E(32554): 1e-26
Smith-Waterman score: 380; 100.0% identity (100.0% similar) in 61 aa overlap (1-61:1-61)

               10        20        30        40        50        60
pF1KE5 MKRFLFLLLTISLLVMVQIQTGLSGQNDTSQTSSPSASSNISGGIFLFFVANAIIHLFCF
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS30 MKRFLFLLLTISLLVMVQIQTGLSGQNDTSQTSSPSASSNISGGIFLFFVANAIIHLFCF
               10        20        30        40        50        60

        
pF1KE5 S
       :
CCDS30 S
        




61 residues in 1 query   sequences
18511270 residues in 32554 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Tue Nov  8 04:52:59 2016 done: Tue Nov  8 04:52:59 2016
 Total Scan time:  1.180 Total Display time: -0.030

Function used was FASTA [36.3.4 Apr, 2011]