FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE3198, 165 aa 1>>>pF1KE3198 165 - 165 aa - 165 aa Library: /omim/omim.rfq.tfa 60827320 residues in 85289 sequences Statistics: Expectation_n fit: rho(ln(x))= 6.4402+/-0.000266; mu= 8.6190+/- 0.017 mean_var=115.2209+/-22.991, 0's: 0 Z-trim(123.2): 4 B-trim: 246 in 2/53 Lambda= 0.119484 statistics sampled from 42567 (42580) to 42567 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.824), E-opt: 0.2 (0.499), width: 16 Scan time: 5.680 The best scores are: opt bits E(85289) NP_001092926 (OMIM: 607997) neuropeptide W preprop ( 165) 1140 205.9 2.4e-53 NP_683694 (OMIM: 607996) neuropeptide B preproprot ( 125) 173 39.1 0.0029 >>NP_001092926 (OMIM: 607997) neuropeptide W preproprote (165 aa) initn: 1140 init1: 1140 opt: 1140 Z-score: 1078.8 bits: 205.9 E(85289): 2.4e-53 Smith-Waterman score: 1140; 100.0% identity (100.0% similar) in 165 aa overlap (1-165:1-165) 10 20 30 40 50 60 pF1KE3 MAWRPGERGAPASRPRLALLLLLLLLPLPSGAWYKHVASPRYHTVGRAAGLLMGLRRSPY :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_001 MAWRPGERGAPASRPRLALLLLLLLLPLPSGAWYKHVASPRYHTVGRAAGLLMGLRRSPY 10 20 30 40 50 60 70 80 90 100 110 120 pF1KE3 LWRRALRAAAGPLARDTLSPEPAAREAPLLLPSWVQELWETRRRSSQAGIPVRAPRSPRA :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_001 LWRRALRAAAGPLARDTLSPEPAAREAPLLLPSWVQELWETRRRSSQAGIPVRAPRSPRA 70 80 90 100 110 120 130 140 150 160 pF1KE3 PEPALEPESLDFSGAGQRLRRDVSRPAVDPAANRLGLPCLAPGPF ::::::::::::::::::::::::::::::::::::::::::::: NP_001 PEPALEPESLDFSGAGQRLRRDVSRPAVDPAANRLGLPCLAPGPF 130 140 150 160 >>NP_683694 (OMIM: 607996) neuropeptide B preproprotein (125 aa) initn: 170 init1: 170 opt: 173 Z-score: 179.6 bits: 39.1 E(85289): 0.0029 Smith-Waterman score: 173; 53.1% identity (64.1% similar) in 64 aa overlap (18-81:11-73) 10 20 30 40 50 60 pF1KE3 MAWRPGERGAPASRPRLALLLLLLLLPLPSGAWYKHVASPRYHTVGRAAGLLMGLRRSPY :: : ::: : :. :::: .:. ..:::::::: ::::::: NP_683 MARSATLAAAALALCLLLAP-PGLAWYKPAAGHSSYSVGRAAGLLSGLRRSPY 10 20 30 40 50 70 80 90 100 110 120 pF1KE3 LWRRALRAAAGPLARDTLSPEPAAREAPLLLPSWVQELWETRRRSSQAGIPVRAPRSPRA : .: : . ::: NP_683 ARRSQPYRGAEPPGGAGASPELQLHPRLRSLAVCVQDVAPNLQRCERLPDGRGTYQCKAN 60 70 80 90 100 110 165 residues in 1 query sequences 60827320 residues in 85289 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Tue Nov 8 04:47:40 2016 done: Tue Nov 8 04:47:41 2016 Total Scan time: 5.680 Total Display time: 0.000 Function used was FASTA [36.3.4 Apr, 2011]