FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE3198, 165 aa 1>>>pF1KE3198 165 - 165 aa - 165 aa Library: human.CCDS.faa 18511270 residues in 32554 sequences Statistics: Expectation_n fit: rho(ln(x))= 6.2780+/-0.000611; mu= 9.9222+/- 0.037 mean_var=113.1845+/-22.612, 0's: 0 Z-trim(116.2): 11 B-trim: 0 in 0/52 Lambda= 0.120554 statistics sampled from 16801 (16810) to 16801 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.83), E-opt: 0.2 (0.516), width: 16 Scan time: 2.270 The best scores are: opt bits E(32554) CCDS42102.1 NPW gene_id:283869|Hs108|chr16 ( 165) 1140 207.5 3.1e-54 >>CCDS42102.1 NPW gene_id:283869|Hs108|chr16 (165 aa) initn: 1140 init1: 1140 opt: 1140 Z-score: 1087.2 bits: 207.5 E(32554): 3.1e-54 Smith-Waterman score: 1140; 100.0% identity (100.0% similar) in 165 aa overlap (1-165:1-165) 10 20 30 40 50 60 pF1KE3 MAWRPGERGAPASRPRLALLLLLLLLPLPSGAWYKHVASPRYHTVGRAAGLLMGLRRSPY :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS42 MAWRPGERGAPASRPRLALLLLLLLLPLPSGAWYKHVASPRYHTVGRAAGLLMGLRRSPY 10 20 30 40 50 60 70 80 90 100 110 120 pF1KE3 LWRRALRAAAGPLARDTLSPEPAAREAPLLLPSWVQELWETRRRSSQAGIPVRAPRSPRA :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS42 LWRRALRAAAGPLARDTLSPEPAAREAPLLLPSWVQELWETRRRSSQAGIPVRAPRSPRA 70 80 90 100 110 120 130 140 150 160 pF1KE3 PEPALEPESLDFSGAGQRLRRDVSRPAVDPAANRLGLPCLAPGPF ::::::::::::::::::::::::::::::::::::::::::::: CCDS42 PEPALEPESLDFSGAGQRLRRDVSRPAVDPAANRLGLPCLAPGPF 130 140 150 160 165 residues in 1 query sequences 18511270 residues in 32554 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Tue Nov 8 04:47:40 2016 done: Tue Nov 8 04:47:40 2016 Total Scan time: 2.270 Total Display time: -0.010 Function used was FASTA [36.3.4 Apr, 2011]