FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE5072, 150 aa 1>>>pF1KE5072 150 - 150 aa - 150 aa Library: human.CCDS.faa 18511270 residues in 32554 sequences Statistics: Expectation_n fit: rho(ln(x))= 5.0930+/-0.00058; mu= 13.5732+/- 0.035 mean_var=75.8584+/-14.532, 0's: 0 Z-trim(114.4): 75 B-trim: 170 in 1/49 Lambda= 0.147256 statistics sampled from 14839 (14938) to 14839 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.812), E-opt: 0.2 (0.459), width: 16 Scan time: 1.580 The best scores are: opt bits E(32554) CCDS1187.1 DUSP23 gene_id:54935|Hs108|chr1 ( 150) 1039 228.8 9.5e-61 >>CCDS1187.1 DUSP23 gene_id:54935|Hs108|chr1 (150 aa) initn: 1039 init1: 1039 opt: 1039 Z-score: 1204.1 bits: 228.8 E(32554): 9.5e-61 Smith-Waterman score: 1039; 100.0% identity (100.0% similar) in 150 aa overlap (1-150:1-150) 10 20 30 40 50 60 pF1KE5 MGVQPPNFSWVLPGRLAGLALPRLPAHYQFLLDLGVRHLVSLTERGPPHSDSCPGLTLHR :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS11 MGVQPPNFSWVLPGRLAGLALPRLPAHYQFLLDLGVRHLVSLTERGPPHSDSCPGLTLHR 10 20 30 40 50 60 70 80 90 100 110 120 pF1KE5 LRIPDFCPPAPDQIDRFVQIVDEANARGEAVGVHCALGFGRTGTMLACYLVKERGLAAGD :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS11 LRIPDFCPPAPDQIDRFVQIVDEANARGEAVGVHCALGFGRTGTMLACYLVKERGLAAGD 70 80 90 100 110 120 130 140 150 pF1KE5 AIAEIRRLRPGSIETYEQEKAVFQFYQRTK :::::::::::::::::::::::::::::: CCDS11 AIAEIRRLRPGSIETYEQEKAVFQFYQRTK 130 140 150 150 residues in 1 query sequences 18511270 residues in 32554 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Tue Nov 8 04:46:08 2016 done: Tue Nov 8 04:46:09 2016 Total Scan time: 1.580 Total Display time: -0.020 Function used was FASTA [36.3.4 Apr, 2011]