FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE5053, 169 aa 1>>>pF1KE5053 169 - 169 aa - 169 aa Library: human.CCDS.faa 18511270 residues in 32554 sequences Statistics: Expectation_n fit: rho(ln(x))= 7.5671+/-0.000654; mu= 5.7534+/- 0.040 mean_var=158.3142+/-31.722, 0's: 0 Z-trim(117.0): 3 B-trim: 0 in 0/53 Lambda= 0.101933 statistics sampled from 17678 (17681) to 17678 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.837), E-opt: 0.2 (0.543), width: 16 Scan time: 1.810 The best scores are: opt bits E(32554) CCDS32881.1 VMAC gene_id:400673|Hs108|chr19 ( 169) 1106 172.6 1e-43 >>CCDS32881.1 VMAC gene_id:400673|Hs108|chr19 (169 aa) initn: 1106 init1: 1106 opt: 1106 Z-score: 898.3 bits: 172.6 E(32554): 1e-43 Smith-Waterman score: 1106; 99.4% identity (100.0% similar) in 169 aa overlap (1-169:1-169) 10 20 30 40 50 60 pF1KE5 MSAPPALQIREANAHLAAVHRRAAELEARLDAAERTVHAQAERLALHDQQLRAALDELGR :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS32 MSAPPALQIREANAHLAAVHRRAAELEARLDAAERTVHAQAERLALHDQQLRAALDELGR 10 20 30 40 50 60 70 80 90 100 110 120 pF1KE5 AKDREIATLQEQLMTSEATVHSLQATVHQRDELIRQLQPRAELLQDICHRRPPLAGLLDA ::::::::::::::::::::::::::::::::::::::::::::::::.::::::::::: CCDS32 AKDREIATLQEQLMTSEATVHSLQATVHQRDELIRQLQPRAELLQDICRRRPPLAGLLDA 70 80 90 100 110 120 130 140 150 160 pF1KE5 LAEAERLGPLPASDPGHPPPGGPGPPLDNSTGEEADRDHLQPAVFGTTV ::::::::::::::::::::::::::::::::::::::::::::::::: CCDS32 LAEAERLGPLPASDPGHPPPGGPGPPLDNSTGEEADRDHLQPAVFGTTV 130 140 150 160 169 residues in 1 query sequences 18511270 residues in 32554 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Tue Nov 8 04:34:22 2016 done: Tue Nov 8 04:34:23 2016 Total Scan time: 1.810 Total Display time: -0.040 Function used was FASTA [36.3.4 Apr, 2011]