FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE5156, 113 aa 1>>>pF1KE5156 113 - 113 aa - 113 aa Library: human.CCDS.faa 18511270 residues in 32554 sequences Statistics: Expectation_n fit: rho(ln(x))= 6.0571+/-0.000646; mu= 6.6532+/- 0.038 mean_var=102.6944+/-21.285, 0's: 0 Z-trim(113.6): 112 B-trim: 281 in 1/50 Lambda= 0.126561 statistics sampled from 14075 (14243) to 14075 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.808), E-opt: 0.2 (0.438), width: 16 Scan time: 1.390 The best scores are: opt bits E(32554) CCDS54432.1 SPEG gene_id:10290|Hs108|chr2 ( 113) 767 149.3 4.8e-37 CCDS42824.1 SPEG gene_id:10290|Hs108|chr2 (3267) 753 147.8 3.7e-35 >>CCDS54432.1 SPEG gene_id:10290|Hs108|chr2 (113 aa) initn: 767 init1: 767 opt: 767 Z-score: 778.5 bits: 149.3 E(32554): 4.8e-37 Smith-Waterman score: 767; 100.0% identity (100.0% similar) in 113 aa overlap (1-113:1-113) 10 20 30 40 50 60 pF1KE5 MKPSPSQNRRSSDTGSKAPPTFKVSLMDQSVREGQDVIMSIRVQGEPKPVVSWLRNRQPV :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS54 MKPSPSQNRRSSDTGSKAPPTFKVSLMDQSVREGQDVIMSIRVQGEPKPVVSWLRNRQPV 10 20 30 40 50 60 70 80 90 100 110 pF1KE5 RPDQRRFAEEAEGGLCRLRILAAERGDAGFYTCKAVNEYGARQCEARLEVRGE ::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS54 RPDQRRFAEEAEGGLCRLRILAAERGDAGFYTCKAVNEYGARQCEARLEVRGE 70 80 90 100 110 >>CCDS42824.1 SPEG gene_id:10290|Hs108|chr2 (3267 aa) initn: 753 init1: 753 opt: 753 Z-score: 744.6 bits: 147.8 E(32554): 3.7e-35 Smith-Waterman score: 753; 100.0% identity (100.0% similar) in 111 aa overlap (1-111:850-960) 10 20 30 pF1KE5 MKPSPSQNRRSSDTGSKAPPTFKVSLMDQS :::::::::::::::::::::::::::::: CCDS42 FSSPITSDEEYLSPPEEFPEPGETWPRTPTMKPSPSQNRRSSDTGSKAPPTFKVSLMDQS 820 830 840 850 860 870 40 50 60 70 80 90 pF1KE5 VREGQDVIMSIRVQGEPKPVVSWLRNRQPVRPDQRRFAEEAEGGLCRLRILAAERGDAGF :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS42 VREGQDVIMSIRVQGEPKPVVSWLRNRQPVRPDQRRFAEEAEGGLCRLRILAAERGDAGF 880 890 900 910 920 930 100 110 pF1KE5 YTCKAVNEYGARQCEARLEVRGE ::::::::::::::::::::: CCDS42 YTCKAVNEYGARQCEARLEVRAHPESRSLAVLAPLQDVDVGAGEMALFECLVAGPTDVEV 940 950 960 970 980 990 113 residues in 1 query sequences 18511270 residues in 32554 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Mon Nov 7 22:03:01 2016 done: Mon Nov 7 22:03:01 2016 Total Scan time: 1.390 Total Display time: -0.010 Function used was FASTA [36.3.4 Apr, 2011]