FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE5162, 112 aa 1>>>pF1KE5162 112 - 112 aa - 112 aa Library: human.CCDS.faa 18511270 residues in 32554 sequences Statistics: Expectation_n fit: rho(ln(x))= 4.9026+/-0.000457; mu= 12.7319+/- 0.028 mean_var=62.8662+/-12.362, 0's: 0 Z-trim(116.4): 11 B-trim: 0 in 0/52 Lambda= 0.161758 statistics sampled from 16979 (16990) to 16979 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.864), E-opt: 0.2 (0.522), width: 16 Scan time: 1.600 The best scores are: opt bits E(32554) CCDS46115.1 PPM1N gene_id:147699|Hs108|chr19 ( 430) 763 185.5 2.3e-47 CCDS9744.1 PPM1A gene_id:5494|Hs108|chr14 ( 382) 255 66.9 1e-11 CCDS45120.1 PPM1A gene_id:5494|Hs108|chr14 ( 455) 255 66.9 1.2e-11 >>CCDS46115.1 PPM1N gene_id:147699|Hs108|chr19 (430 aa) initn: 763 init1: 763 opt: 763 Z-score: 963.8 bits: 185.5 E(32554): 2.3e-47 Smith-Waterman score: 763; 100.0% identity (100.0% similar) in 112 aa overlap (1-112:319-430) 10 20 30 pF1KE5 MTCILVCFPGAPRPSEEAIRRELALDAALG :::::::::::::::::::::::::::::: CCDS46 VASRLRLGLAPELLCAQLLDTCLCKGSLDNMTCILVCFPGAPRPSEEAIRRELALDAALG 290 300 310 320 330 340 40 50 60 70 80 90 pF1KE5 CRIAELCASAQKPPSLNTVFRTLASEDIPDLPPGGGLDCKATVIAEVYSQICQVSEECGE :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS46 CRIAELCASAQKPPSLNTVFRTLASEDIPDLPPGGGLDCKATVIAEVYSQICQVSEECGE 350 360 370 380 390 400 100 110 pF1KE5 KGQDGAGKSNPTHLGSALDMEA :::::::::::::::::::::: CCDS46 KGQDGAGKSNPTHLGSALDMEA 410 420 430 >>CCDS9744.1 PPM1A gene_id:5494|Hs108|chr14 (382 aa) initn: 262 init1: 139 opt: 255 Z-score: 323.9 bits: 66.9 E(32554): 1e-11 Smith-Waterman score: 255; 48.8% identity (73.2% similar) in 82 aa overlap (1-81:284-365) 10 20 30 pF1KE5 MTCILVCFPGAPRPSEEAIRRELALDAALG :. ::.:::.::. : ::...: :: : CCDS97 VRSRLEVTDDLEKVCNEVVDTCLYKGSRDNMSVILICFPNAPKVSPEAVKKEAELDKYLE 260 270 280 290 300 310 40 50 60 70 80 pF1KE5 CRIAELCAS-AQKPPSLNTVFRTLASEDIPDLPPGGGLDCKATVIAEVYSQICQVSEECG ::. :. . .. :.: :.::::::.::.::::: : : .:: ::... CCDS97 CRVEEIIKKQGEGVPDLVHVMRTLASENIPSLPPGGELASKRNVIEAVYNRLNPYKNDDT 320 330 340 350 360 370 90 100 110 pF1KE5 EKGQDGAGKSNPTHLGSALDMEA CCDS97 DSTSTDDMW 380 >>CCDS45120.1 PPM1A gene_id:5494|Hs108|chr14 (455 aa) initn: 262 init1: 139 opt: 255 Z-score: 322.8 bits: 66.9 E(32554): 1.2e-11 Smith-Waterman score: 255; 48.8% identity (73.2% similar) in 82 aa overlap (1-81:357-438) 10 20 30 pF1KE5 MTCILVCFPGAPRPSEEAIRRELALDAALG :. ::.:::.::. : ::...: :: : CCDS45 VRSRLEVTDDLEKVCNEVVDTCLYKGSRDNMSVILICFPNAPKVSPEAVKKEAELDKYLE 330 340 350 360 370 380 40 50 60 70 80 pF1KE5 CRIAELCAS-AQKPPSLNTVFRTLASEDIPDLPPGGGLDCKATVIAEVYSQICQVSEECG ::. :. . .. :.: :.::::::.::.::::: : : .:: ::... CCDS45 CRVEEIIKKQGEGVPDLVHVMRTLASENIPSLPPGGELASKRNVIEAVYNRLNPYKNDDT 390 400 410 420 430 440 90 100 110 pF1KE5 EKGQDGAGKSNPTHLGSALDMEA CCDS45 DSTSTDDMW 450 112 residues in 1 query sequences 18511270 residues in 32554 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Mon Nov 7 22:11:06 2016 done: Mon Nov 7 22:11:06 2016 Total Scan time: 1.600 Total Display time: -0.020 Function used was FASTA [36.3.4 Apr, 2011]