FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE6566, 184 aa 1>>>pF1KE6566 184 - 184 aa - 184 aa Library: human.CCDS.faa 18511270 residues in 32554 sequences Statistics: Expectation_n fit: rho(ln(x))= 5.3179+/-0.000606; mu= 12.3451+/- 0.036 mean_var=58.9220+/-11.780, 0's: 0 Z-trim(110.6): 4 B-trim: 62 in 1/49 Lambda= 0.167084 statistics sampled from 11732 (11734) to 11732 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.755), E-opt: 0.2 (0.36), width: 16 Scan time: 1.530 The best scores are: opt bits E(32554) CCDS4837.1 GLO1 gene_id:2739|Hs108|chr6 ( 184) 1269 313.6 4.4e-86 >>CCDS4837.1 GLO1 gene_id:2739|Hs108|chr6 (184 aa) initn: 1269 init1: 1269 opt: 1269 Z-score: 1658.9 bits: 313.6 E(32554): 4.4e-86 Smith-Waterman score: 1269; 100.0% identity (100.0% similar) in 184 aa overlap (1-184:1-184) 10 20 30 40 50 60 pF1KE6 MAEPQPPSGGLTDEAALSCCSDADPSTKDFLLQQTMLRVKDPKKSLDFYTRVLGMTLIQK :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS48 MAEPQPPSGGLTDEAALSCCSDADPSTKDFLLQQTMLRVKDPKKSLDFYTRVLGMTLIQK 10 20 30 40 50 60 70 80 90 100 110 120 pF1KE6 CDFPIMKFSLYFLAYEDKNDIPKEKDEKIAWALSRKATLELTHNWGTEDDETQSYHNGNS :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS48 CDFPIMKFSLYFLAYEDKNDIPKEKDEKIAWALSRKATLELTHNWGTEDDETQSYHNGNS 70 80 90 100 110 120 130 140 150 160 170 180 pF1KE6 DPRGFGHIGIAVPDVYSACKRFEELGVKFVKKPDDGKMKGLAFIQDPDGYWIEILNPNKM :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS48 DPRGFGHIGIAVPDVYSACKRFEELGVKFVKKPDDGKMKGLAFIQDPDGYWIEILNPNKM 130 140 150 160 170 180 pF1KE6 ATLM :::: CCDS48 ATLM 184 residues in 1 query sequences 18511270 residues in 32554 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Tue Nov 8 14:28:04 2016 done: Tue Nov 8 14:28:04 2016 Total Scan time: 1.530 Total Display time: -0.020 Function used was FASTA [36.3.4 Apr, 2011]