Result of FASTA (ccds) for pFN21AE2753
FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KE2753, 69 aa
  1>>>pF1KE2753     69 - 69 aa - 69 aa
Library: human.CCDS.faa
  18921897 residues in 33420 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 4.4107+/-0.000472; mu= 10.6135+/- 0.028
 mean_var=45.1740+/- 8.936, 0's: 0 Z-trim(113.4): 16  B-trim: 70 in 1/51
 Lambda= 0.190823
 statistics sampled from 14189 (14201) to 14189 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.826), E-opt: 0.2 (0.425), width:  16
 Scan time:  0.700

The best scores are:                                      opt bits E(33420)
CCDS42457.1 GPX4 gene_id:2879|Hs109|chr19          ( 197)  505 145.5 7.3e-36


>>CCDS42457.1 GPX4 gene_id:2879|Hs109|chr19               (197 aa)
 initn: 505 init1: 505 opt: 505  Z-score: 757.6  bits: 145.5 E(33420): 7.3e-36
Smith-Waterman score: 505; 100.0% identity (100.0% similar) in 69 aa overlap (1-69:129-197)

                                             10        20        30
pF1KE2                               MFSKICVNGDDAHPLWKWMKIQPKGKGILG
                                     ::::::::::::::::::::::::::::::
CCDS42 AFPCNQFGKQEPGSNEEIKEFAAGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILG
      100       110       120       130       140       150        

               40        50        60         
pF1KE2 NAIKWNFTKFLIDKNGCVVKRYGPMEEPLVIEKDLPHYF
       :::::::::::::::::::::::::::::::::::::::
CCDS42 NAIKWNFTKFLIDKNGCVVKRYGPMEEPLVIEKDLPHYF
      160       170       180       190       




69 residues in 1 query   sequences
18921897 residues in 33420 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Sun Jun 30 14:55:32 2019 done: Sun Jun 30 14:55:32 2019
 Total Scan time:  0.700 Total Display time:  0.010

Function used was FASTA [36.3.4 Apr, 2011]
Inquiries or Suggestions ?
Send a message to flexiclone AT kazusagt.com