FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE6192, 83 aa 1>>>pF1KE6192 83 - 83 aa - 83 aa Library: human.CCDS.faa 18511270 residues in 32554 sequences Statistics: Expectation_n fit: rho(ln(x))= 5.0476+/-0.000551; mu= 8.8795+/- 0.033 mean_var=47.9765+/- 9.312, 0's: 0 Z-trim(111.2): 4 B-trim: 0 in 0/52 Lambda= 0.185165 statistics sampled from 12179 (12182) to 12179 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.786), E-opt: 0.2 (0.374), width: 16 Scan time: 1.120 The best scores are: opt bits E(32554) CCDS82020.1 COX4I1 gene_id:1327|Hs108|chr16 ( 139) 510 143.0 3.5e-35 CCDS10955.1 COX4I1 gene_id:1327|Hs108|chr16 ( 169) 510 143.0 4.2e-35 >>CCDS82020.1 COX4I1 gene_id:1327|Hs108|chr16 (139 aa) initn: 510 init1: 510 opt: 510 Z-score: 745.2 bits: 143.0 E(32554): 3.5e-35 Smith-Waterman score: 510; 100.0% identity (100.0% similar) in 80 aa overlap (1-80:1-80) 10 20 30 40 50 60 pF1KE6 MLATRVFSLVGKRAISTSVCVRAHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQK :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS82 MLATRVFSLVGKRAISTSVCVRAHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQK 10 20 30 40 50 60 70 80 pF1KE6 ALKEKEKASWSSLSMDEKVECGY :::::::::::::::::::: CCDS82 ALKEKEKASWSSLSMDEKVELYRIKFKESFAEMNRGSNEWKTVVGGAMFFIGFTALVIMW 70 80 90 100 110 120 >>CCDS10955.1 COX4I1 gene_id:1327|Hs108|chr16 (169 aa) initn: 510 init1: 510 opt: 510 Z-score: 743.8 bits: 143.0 E(32554): 4.2e-35 Smith-Waterman score: 510; 100.0% identity (100.0% similar) in 80 aa overlap (1-80:1-80) 10 20 30 40 50 60 pF1KE6 MLATRVFSLVGKRAISTSVCVRAHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQK :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS10 MLATRVFSLVGKRAISTSVCVRAHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQK 10 20 30 40 50 60 70 80 pF1KE6 ALKEKEKASWSSLSMDEKVECGY :::::::::::::::::::: CCDS10 ALKEKEKASWSSLSMDEKVELYRIKFKESFAEMNRGSNEWKTVVGGAMFFIGFTALVIMW 70 80 90 100 110 120 83 residues in 1 query sequences 18511270 residues in 32554 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Tue Nov 8 10:13:41 2016 done: Tue Nov 8 10:13:41 2016 Total Scan time: 1.120 Total Display time: -0.020 Function used was FASTA [36.3.4 Apr, 2011]