Result of FASTA (ccds) for pFN21AE6522
FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KE6522, 85 aa
  1>>>pF1KE6522 85 - 85 aa - 85 aa
Library: human.CCDS.faa
  18511270 residues in 32554 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 4.9231+/-0.000522; mu= 9.3652+/- 0.031
 mean_var=47.6310+/- 9.492, 0's: 0 Z-trim(111.5): 9  B-trim: 0 in 0/50
 Lambda= 0.185836
 statistics sampled from 12457 (12463) to 12457 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.788), E-opt: 0.2 (0.383), width:  16
 Scan time:  1.220

The best scores are:                                      opt bits E(32554)
CCDS11855.1 IMPA2 gene_id:3613|Hs108|chr18         ( 288)  490 138.2   2e-33
CCDS47884.1 IMPA1 gene_id:3612|Hs108|chr8          ( 198)  208 62.5 8.2e-11


>>CCDS11855.1 IMPA2 gene_id:3613|Hs108|chr18              (288 aa)
 initn: 490 init1: 490 opt: 490  Z-score: 713.5  bits: 138.2 E(32554): 2e-33
Smith-Waterman score: 490; 100.0% identity (100.0% similar) in 77 aa overlap (1-77:1-77)

               10        20        30        40        50        60
pF1KE6 MKPSGEDQAALAAGPWEECFQAAVQLALRAGQIIRKALTEEKRVSTKTSAADLVTETDHL
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS11 MKPSGEDQAALAAGPWEECFQAAVQLALRAGQIIRKALTEEKRVSTKTSAADLVTETDHL
               10        20        30        40        50        60

               70        80                                        
pF1KE6 VEDLIISELRERFPSHRSPFSLVHM                                   
       :::::::::::::::::                                           
CCDS11 VEDLIISELRERFPSHRFIAEEAAASGAKCVLTHSPTWIIDPIDGTCNFVHRFPTVAVSI
               70        80        90       100       110       120

>>CCDS47884.1 IMPA1 gene_id:3612|Hs108|chr8               (198 aa)
 initn: 228 init1: 208 opt: 208  Z-score: 307.6  bits: 62.5 E(32554): 8.2e-11
Smith-Waterman score: 208; 46.9% identity (76.6% similar) in 64 aa overlap (13-76:2-65)

               10        20        30        40        50        60
pF1KE6 MKPSGEDQAALAAGPWEECFQAAVQLALRAGQIIRKALTEEKRVSTKTSAADLVTETDHL
                   : ::.::.. :: :: .::... .:. .:  :  :.: .:::: ::. 
CCDS47            MADPWQECMDYAVTLARQAGEVVCEAIKNEMNVMLKSSPVDLVTATDQK
                          10        20        30        40         

               70        80                                        
pF1KE6 VEDLIISELRERFPSHRSPFSLVHM                                   
       :: ..:: ..:..:::                                            
CCDS47 VEKMLISSIKEKYPSHSFIGEESVAAGEKSILTDNPTWIIDPIDGTTNFVHRFPFVAVSI
      50        60        70        80        90       100         




85 residues in 1 query   sequences
18511270 residues in 32554 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Tue Nov  8 14:04:19 2016 done: Tue Nov  8 14:04:19 2016
 Total Scan time:  1.220 Total Display time: -0.030

Function used was FASTA [36.3.4 Apr, 2011]
Inquiries or Suggestions ?
Send a message to flexiclone AT kazusagt.com