FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE6159, 121 aa 1>>>pF1KE6159 121 - 121 aa - 121 aa Library: human.CCDS.faa 18511270 residues in 32554 sequences Statistics: Expectation_n fit: rho(ln(x))= 5.2568+/-0.000498; mu= 12.7953+/- 0.030 mean_var=81.3977+/-16.250, 0's: 0 Z-trim(117.5): 6 B-trim: 438 in 1/52 Lambda= 0.142157 statistics sampled from 18283 (18286) to 18283 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.863), E-opt: 0.2 (0.562), width: 16 Scan time: 1.270 The best scores are: opt bits E(32554) CCDS7709.1 SCT gene_id:6343|Hs108|chr11 ( 121) 831 178.1 1.1e-45 >>CCDS7709.1 SCT gene_id:6343|Hs108|chr11 (121 aa) initn: 831 init1: 831 opt: 831 Z-score: 933.4 bits: 178.1 E(32554): 1.1e-45 Smith-Waterman score: 831; 100.0% identity (100.0% similar) in 121 aa overlap (1-121:1-121) 10 20 30 40 50 60 pF1KE6 MAPRPLLLLLLLLGGSAARPAPPRARRHSDGTFTSELSRLREGARLQRLLQGLVGKRSEQ :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS77 MAPRPLLLLLLLLGGSAARPAPPRARRHSDGTFTSELSRLREGARLQRLLQGLVGKRSEQ 10 20 30 40 50 60 70 80 90 100 110 120 pF1KE6 DAENSMAWTRLSAGLLCPSGSNMPILQAWMPLDGTWSPWLPPGPMVSEPAGAAAEGTLRP :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS77 DAENSMAWTRLSAGLLCPSGSNMPILQAWMPLDGTWSPWLPPGPMVSEPAGAAAEGTLRP 70 80 90 100 110 120 pF1KE6 R : CCDS77 R 121 residues in 1 query sequences 18511270 residues in 32554 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Tue Nov 8 09:57:51 2016 done: Tue Nov 8 09:57:51 2016 Total Scan time: 1.270 Total Display time: -0.030 Function used was FASTA [36.3.4 Apr, 2011]