FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE6143, 61 aa 1>>>pF1KE6143 61 - 61 aa - 61 aa Library: /omim/omim.rfq.tfa 60827320 residues in 85289 sequences Statistics: Expectation_n fit: rho(ln(x))= 6.0103+/-0.000304; mu= 4.7727+/- 0.019 mean_var=148.7048+/-28.586, 0's: 0 Z-trim(122.2): 43 B-trim: 216 in 1/53 Lambda= 0.105175 statistics sampled from 39985 (40036) to 39985 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.784), E-opt: 0.2 (0.469), width: 16 Scan time: 2.790 The best scores are: opt bits E(85289) NP_005937 (OMIM: 156350) metallothionein-1A [Homo ( 61) 506 86.1 3.9e-18 NP_783316 (OMIM: 156351) metallothionein-1E [Homo ( 61) 489 83.5 2.3e-17 NP_005944 (OMIM: 156360) metallothionein-2 [Homo s ( 61) 472 80.9 1.4e-16 NP_005942 (OMIM: 156354) metallothionein-1H [Homo ( 61) 471 80.8 1.5e-16 NP_005941 (OMIM: 156353) metallothionein-1G isofor ( 61) 465 79.9 2.9e-16 NP_005938 (OMIM: 156349) metallothionein-1B [Homo ( 61) 463 79.6 3.5e-16 NP_005940 (OMIM: 156352) metallothionein-1F isofor ( 61) 463 79.6 3.5e-16 NP_001288196 (OMIM: 156353) metallothionein-1G iso ( 62) 457 78.7 6.7e-16 NP_005943 (OMIM: 156359) metallothionein-1X [Homo ( 61) 454 78.2 9.1e-16 NP_789846 (OMIM: 156357) metallothionein-1M [Homo ( 61) 447 77.1 1.9e-15 NP_005945 (OMIM: 139255) metallothionein-3 [Homo s ( 68) 373 66.0 4.9e-12 NP_116324 (OMIM: 606206) metallothionein-4 [Homo s ( 62) 370 65.5 6.3e-12 XP_005256013 (OMIM: 156351) PREDICTED: metallothio ( 127) 259 49.0 1.2e-06 NP_001288201 (OMIM: 156352) metallothionein-1F iso ( 44) 244 46.2 2.9e-06 NP_001005922 (OMIM: 148022) keratin-associated pro ( 278) 185 38.2 0.0046 NP_005544 (OMIM: 148021) keratin-associated protei ( 169) 179 37.0 0.0063 >>NP_005937 (OMIM: 156350) metallothionein-1A [Homo sapi (61 aa) initn: 506 init1: 506 opt: 506 Z-score: 446.7 bits: 86.1 E(85289): 3.9e-18 Smith-Waterman score: 506; 98.4% identity (100.0% similar) in 61 aa overlap (1-61:1-61) 10 20 30 40 50 60 pF1KE6 MDPNCSCATGGSCTCTGSCKCKECKCNSCKKSCCSCCPMSCAKCAQGCICKGASEKCSCC ::::::::::::::::::::::::::.::::::::::::::::::::::::::::::::: NP_005 MDPNCSCATGGSCTCTGSCKCKECKCTSCKKSCCSCCPMSCAKCAQGCICKGASEKCSCC 10 20 30 40 50 60 pF1KE6 A : NP_005 A >>NP_783316 (OMIM: 156351) metallothionein-1E [Homo sapi (61 aa) initn: 489 init1: 489 opt: 489 Z-score: 432.7 bits: 83.5 E(85289): 2.3e-17 Smith-Waterman score: 489; 91.8% identity (100.0% similar) in 61 aa overlap (1-61:1-61) 10 20 30 40 50 60 pF1KE6 MDPNCSCATGGSCTCTGSCKCKECKCNSCKKSCCSCCPMSCAKCAQGCICKGASEKCSCC :::::::::::::::.::::::::::.:::::::::::..::::::::.::::::::::: NP_783 MDPNCSCATGGSCTCAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCVCKGASEKCSCC 10 20 30 40 50 60 pF1KE6 A : NP_783 A >>NP_005944 (OMIM: 156360) metallothionein-2 [Homo sapie (61 aa) initn: 472 init1: 472 opt: 472 Z-score: 418.8 bits: 80.9 E(85289): 1.4e-16 Smith-Waterman score: 472; 88.5% identity (98.4% similar) in 61 aa overlap (1-61:1-61) 10 20 30 40 50 60 pF1KE6 MDPNCSCATGGSCTCTGSCKCKECKCNSCKKSCCSCCPMSCAKCAQGCICKGASEKCSCC ::::::::.: ::::.::::::::::.:::::::::::..::::::::::::::.::::: NP_005 MDPNCSCAAGDSCTCAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASDKCSCC 10 20 30 40 50 60 pF1KE6 A : NP_005 A >>NP_005942 (OMIM: 156354) metallothionein-1H [Homo sapi (61 aa) initn: 471 init1: 471 opt: 471 Z-score: 418.0 bits: 80.8 E(85289): 1.5e-16 Smith-Waterman score: 471; 86.9% identity (98.4% similar) in 61 aa overlap (1-61:1-61) 10 20 30 40 50 60 pF1KE6 MDPNCSCATGGSCTCTGSCKCKECKCNSCKKSCCSCCPMSCAKCAQGCICKGASEKCSCC ::::::: .::::.:.::::::.:::.:::::::::::..:::::::::::::::::::: NP_005 MDPNCSCEAGGSCACAGSCKCKKCKCTSCKKSCCSCCPLGCAKCAQGCICKGASEKCSCC 10 20 30 40 50 60 pF1KE6 A : NP_005 A >>NP_005941 (OMIM: 156353) metallothionein-1G isoform 1 (61 aa) initn: 465 init1: 465 opt: 465 Z-score: 413.0 bits: 79.9 E(85289): 2.9e-16 Smith-Waterman score: 465; 88.5% identity (98.4% similar) in 61 aa overlap (1-61:1-61) 10 20 30 40 50 60 pF1KE6 MDPNCSCATGGSCTCTGSCKCKECKCNSCKKSCCSCCPMSCAKCAQGCICKGASEKCSCC ::::::::.: ::::..:::::::::.:::::::::::..:::::::::::::::::::: NP_005 MDPNCSCAAGVSCTCASSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASEKCSCC 10 20 30 40 50 60 pF1KE6 A : NP_005 A >>NP_005938 (OMIM: 156349) metallothionein-1B [Homo sapi (61 aa) initn: 463 init1: 463 opt: 463 Z-score: 411.4 bits: 79.6 E(85289): 3.5e-16 Smith-Waterman score: 463; 83.6% identity (96.7% similar) in 61 aa overlap (1-61:1-61) 10 20 30 40 50 60 pF1KE6 MDPNCSCATGGSCTCTGSCKCKECKCNSCKKSCCSCCPMSCAKCAQGCICKGASEKCSCC :::::::.:::::.:.::::::::::.:::: ::::::..::::::::.:::.:::: :: NP_005 MDPNCSCTTGGSCACAGSCKCKECKCTSCKKCCCSCCPVGCAKCAQGCVCKGSSEKCRCC 10 20 30 40 50 60 pF1KE6 A : NP_005 A >>NP_005940 (OMIM: 156352) metallothionein-1F isoform 1 (61 aa) initn: 463 init1: 463 opt: 463 Z-score: 411.4 bits: 79.6 E(85289): 3.5e-16 Smith-Waterman score: 463; 86.7% identity (98.3% similar) in 60 aa overlap (1-60:1-60) 10 20 30 40 50 60 pF1KE6 MDPNCSCATGGSCTCTGSCKCKECKCNSCKKSCCSCCPMSCAKCAQGCICKGASEKCSCC ::::::::.: ::::.::::::::::.:::::::::::..:.::::::.::::::::::: NP_005 MDPNCSCAAGVSCTCAGSCKCKECKCTSCKKSCCSCCPVGCSKCAQGCVCKGASEKCSCC 10 20 30 40 50 60 pF1KE6 A NP_005 D >>NP_001288196 (OMIM: 156353) metallothionein-1G isoform (62 aa) initn: 402 init1: 402 opt: 457 Z-score: 406.4 bits: 78.7 E(85289): 6.7e-16 Smith-Waterman score: 457; 87.1% identity (98.4% similar) in 62 aa overlap (1-61:1-62) 10 20 30 40 50 pF1KE6 MDPNCSCATGG-SCTCTGSCKCKECKCNSCKKSCCSCCPMSCAKCAQGCICKGASEKCSC ::::::::..: ::::..:::::::::.:::::::::::..::::::::::::::::::: NP_001 MDPNCSCAAAGVSCTCASSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASEKCSC 10 20 30 40 50 60 60 pF1KE6 CA :: NP_001 CA >>NP_005943 (OMIM: 156359) metallothionein-1X [Homo sapi (61 aa) initn: 454 init1: 454 opt: 454 Z-score: 404.0 bits: 78.2 E(85289): 9.1e-16 Smith-Waterman score: 454; 83.6% identity (96.7% similar) in 61 aa overlap (1-61:1-61) 10 20 30 40 50 60 pF1KE6 MDPNCSCATGGSCTCTGSCKCKECKCNSCKKSCCSCCPMSCAKCAQGCICKGASEKCSCC :::::::. :::.:.::::::::::.:::::::::::..::::::::::::.:.::::: NP_005 MDPNCSCSPVGSCACAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGTSDKCSCC 10 20 30 40 50 60 pF1KE6 A : NP_005 A >>NP_789846 (OMIM: 156357) metallothionein-1M [Homo sapi (61 aa) initn: 447 init1: 447 opt: 447 Z-score: 398.3 bits: 77.1 E(85289): 1.9e-15 Smith-Waterman score: 447; 82.0% identity (96.7% similar) in 61 aa overlap (1-61:1-61) 10 20 30 40 50 60 pF1KE6 MDPNCSCATGGSCTCTGSCKCKECKCNSCKKSCCSCCPMSCAKCAQGCICKGASEKCSCC :::::::.:: ::.::::::::::::.:::::::::::..:::::.::.:::. :.:::: NP_789 MDPNCSCTTGVSCACTGSCKCKECKCTSCKKSCCSCCPVGCAKCAHGCVCKGTLENCSCC 10 20 30 40 50 60 pF1KE6 A : NP_789 A 61 residues in 1 query sequences 60827320 residues in 85289 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Tue Nov 8 09:50:25 2016 done: Tue Nov 8 09:50:26 2016 Total Scan time: 2.790 Total Display time: -0.030 Function used was FASTA [36.3.4 Apr, 2011]