Result of FASTA (ccds) for pFN21AE6152
FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KE6152, 51 aa
  1>>>pF1KE6152 51 - 51 aa - 51 aa
Library: human.CCDS.faa
  18511270 residues in 32554 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 4.2231+/-0.000517; mu= 9.9562+/- 0.031
 mean_var=45.4969+/- 9.178, 0's: 0 Z-trim(112.1): 13  B-trim: 86 in 1/50
 Lambda= 0.190144
 statistics sampled from 12939 (12946) to 12939 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.799), E-opt: 0.2 (0.398), width:  16
 Scan time:  0.880

The best scores are:                                      opt bits E(32554)
CCDS33999.1 HTN3 gene_id:3347|Hs108|chr4           (  51)  353 103.1   8e-24
CCDS3534.1 HTN1 gene_id:3346|Hs108|chr4            (  57)  285 84.4 3.6e-18


>>CCDS33999.1 HTN3 gene_id:3347|Hs108|chr4                (51 aa)
 initn: 353 init1: 353 opt: 353  Z-score: 541.2  bits: 103.1 E(32554): 8e-24
Smith-Waterman score: 353; 100.0% identity (100.0% similar) in 51 aa overlap (1-51:1-51)

               10        20        30        40        50 
pF1KE6 MKFFVFALILALMLSMTGADSHAKRHHGYKRKFHEKHHSHRGYRSNYLYDN
       :::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS33 MKFFVFALILALMLSMTGADSHAKRHHGYKRKFHEKHHSHRGYRSNYLYDN
               10        20        30        40        50 

>>CCDS3534.1 HTN1 gene_id:3346|Hs108|chr4                 (57 aa)
 initn: 333 init1: 256 opt: 285  Z-score: 439.6  bits: 84.4 E(32554): 3.6e-18
Smith-Waterman score: 285; 75.4% identity (82.5% similar) in 57 aa overlap (1-51:1-57)

               10        20        30        40              50 
pF1KE6 MKFFVFALILALMLSMTGADSHAKRHHGYKRKFHEKHHSHR------GYRSNYLYDN
       ::::::::.::::.:: .:::: ::::::.:::::::::::       : :::::::
CCDS35 MKFFVFALVLALMISMISADSHEKRHHGYRRKFHEKHHSHREFPFYGDYGSNYLYDN
               10        20        30        40        50       




51 residues in 1 query   sequences
18511270 residues in 32554 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Tue Nov  8 09:54:24 2016 done: Tue Nov  8 09:54:24 2016
 Total Scan time:  0.880 Total Display time: -0.040

Function used was FASTA [36.3.4 Apr, 2011]
Inquiries or Suggestions ?
Send a message to flexiclone AT kazusagt.com