FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE9278, 63 aa 1>>>pF1KE9278 63 - 63 aa - 63 aa Library: human.CCDS.faa 18511270 residues in 32554 sequences Statistics: Expectation_n fit: rho(ln(x))= 4.5333+/-0.000464; mu= 10.0988+/- 0.028 mean_var=48.0069+/- 9.572, 0's: 0 Z-trim(114.5): 5 B-trim: 4 in 1/51 Lambda= 0.185107 statistics sampled from 15029 (15033) to 15029 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.838), E-opt: 0.2 (0.462), width: 16 Scan time: 0.990 The best scores are: opt bits E(32554) CCDS32772.1 CENPX gene_id:201254|Hs108|chr17 ( 63) 397 112.2 2.2e-26 CCDS59302.1 CENPX gene_id:201254|Hs108|chr17 ( 58) 345 98.3 3e-22 CCDS59303.1 CENPX gene_id:201254|Hs108|chr17 ( 81) 206 61.3 6e-11 >>CCDS32772.1 CENPX gene_id:201254|Hs108|chr17 (63 aa) initn: 397 init1: 397 opt: 397 Z-score: 587.3 bits: 112.2 E(32554): 2.2e-26 Smith-Waterman score: 397; 98.4% identity (100.0% similar) in 63 aa overlap (1-63:1-63) 10 20 30 40 50 60 pF1KE9 MEGAGAGSGFRKELVSRLLHLHFKDDKTKEAAVRGVRQAQAEDALRADVDQLEKVLPQLL ::::::::::::::::::::::::::::::::::::::::::::::.::::::::::::: CCDS32 MEGAGAGSGFRKELVSRLLHLHFKDDKTKEAAVRGVRQAQAEDALRVDVDQLEKVLPQLL 10 20 30 40 50 60 pF1KE9 LDF ::: CCDS32 LDF >>CCDS59302.1 CENPX gene_id:201254|Hs108|chr17 (58 aa) initn: 361 init1: 345 opt: 345 Z-score: 512.8 bits: 98.3 E(32554): 3e-22 Smith-Waterman score: 345; 96.4% identity (100.0% similar) in 56 aa overlap (1-56:1-56) 10 20 30 40 50 60 pF1KE9 MEGAGAGSGFRKELVSRLLHLHFKDDKTKEAAVRGVRQAQAEDALRADVDQLEKVLPQLL ::::::::::::::::::::::::::::::::::::::::::::::.:::::::.: CCDS59 MEGAGAGSGFRKELVSRLLHLHFKDDKTKEAAVRGVRQAQAEDALRVDVDQLEKLLDF 10 20 30 40 50 pF1KE9 LDF >>CCDS59303.1 CENPX gene_id:201254|Hs108|chr17 (81 aa) initn: 383 init1: 206 opt: 206 Z-score: 310.0 bits: 61.3 E(32554): 6e-11 Smith-Waterman score: 351; 76.5% identity (77.8% similar) in 81 aa overlap (1-63:1-81) 10 20 30 40 pF1KE9 MEGAGAGSGFRKELVSRLLHLHFKDDKTK------------------EAAVRGVRQAQAE ::::::::::::::::::::::::::::: ::::::::::::: CCDS59 MEGAGAGSGFRKELVSRLLHLHFKDDKTKVSGDALQLMVELLKVFVVEAAVRGVRQAQAE 10 20 30 40 50 60 50 60 pF1KE9 DALRADVDQLEKVLPQLLLDF ::::.:::::::::::::::: CCDS59 DALRVDVDQLEKVLPQLLLDF 70 80 63 residues in 1 query sequences 18511270 residues in 32554 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Tue Nov 8 10:16:33 2016 done: Tue Nov 8 10:16:34 2016 Total Scan time: 0.990 Total Display time: -0.020 Function used was FASTA [36.3.4 Apr, 2011]