FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE1102, 76 aa 1>>>pF1KE1102 76 - 76 aa - 76 aa Library: human.CCDS.faa 18511270 residues in 32554 sequences Statistics: Expectation_n fit: rho(ln(x))= 5.1047+/-0.000481; mu= 10.3973+/- 0.029 mean_var=75.8786+/-14.873, 0's: 0 Z-trim(117.0): 3 B-trim: 51 in 1/52 Lambda= 0.147236 statistics sampled from 17663 (17666) to 17663 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.874), E-opt: 0.2 (0.543), width: 16 Scan time: 1.420 The best scores are: opt bits E(32554) CCDS6291.1 ZNF706 gene_id:51123|Hs108|chr8 ( 76) 517 117.1 1e-27 >>CCDS6291.1 ZNF706 gene_id:51123|Hs108|chr8 (76 aa) initn: 517 init1: 517 opt: 517 Z-score: 611.0 bits: 117.1 E(32554): 1e-27 Smith-Waterman score: 517; 100.0% identity (100.0% similar) in 76 aa overlap (1-76:1-76) 10 20 30 40 50 60 pF1KE1 MARGQQKIQSQQKNAKKQAGQKKKQGHDQKAAAKAALIYTCTVCRTQMPDPKTFKQHFES :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS62 MARGQQKIQSQQKNAKKQAGQKKKQGHDQKAAAKAALIYTCTVCRTQMPDPKTFKQHFES 10 20 30 40 50 60 70 pF1KE1 KHPKTPLPPELADVQA :::::::::::::::: CCDS62 KHPKTPLPPELADVQA 70 76 residues in 1 query sequences 18511270 residues in 32554 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Sun Nov 6 20:19:51 2016 done: Sun Nov 6 20:19:51 2016 Total Scan time: 1.420 Total Display time: -0.020 Function used was FASTA [36.3.4 Apr, 2011]