FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE1578, 64 aa 1>>>pF1KE1578 64 - 64 aa - 64 aa Library: human.CCDS.faa 18511270 residues in 32554 sequences Statistics: Expectation_n fit: rho(ln(x))= 4.3366+/-0.000448; mu= 12.2869+/- 0.027 mean_var=59.9767+/-11.730, 0's: 0 Z-trim(118.0): 14 B-trim: 124 in 2/50 Lambda= 0.165609 statistics sampled from 18803 (18817) to 18803 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.894), E-opt: 0.2 (0.578), width: 16 Scan time: 1.260 The best scores are: opt bits E(32554) CCDS5971.1 DEFB4A gene_id:1673|Hs108|chr8 ( 64) 476 120.1 9.3e-29 CCDS55193.1 DEFB4B gene_id:100289462|Hs108|chr8 ( 64) 476 120.1 9.3e-29 >>CCDS5971.1 DEFB4A gene_id:1673|Hs108|chr8 (64 aa) initn: 476 init1: 476 opt: 476 Z-score: 629.8 bits: 120.1 E(32554): 9.3e-29 Smith-Waterman score: 476; 100.0% identity (100.0% similar) in 64 aa overlap (1-64:1-64) 10 20 30 40 50 60 pF1KE1 MRVLYLLFSFLFIFLMPLPGVFGGIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKC :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS59 MRVLYLLFSFLFIFLMPLPGVFGGIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKC 10 20 30 40 50 60 pF1KE1 CKKP :::: CCDS59 CKKP >>CCDS55193.1 DEFB4B gene_id:100289462|Hs108|chr8 (64 aa) initn: 476 init1: 476 opt: 476 Z-score: 629.8 bits: 120.1 E(32554): 9.3e-29 Smith-Waterman score: 476; 100.0% identity (100.0% similar) in 64 aa overlap (1-64:1-64) 10 20 30 40 50 60 pF1KE1 MRVLYLLFSFLFIFLMPLPGVFGGIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKC :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS55 MRVLYLLFSFLFIFLMPLPGVFGGIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKC 10 20 30 40 50 60 pF1KE1 CKKP :::: CCDS55 CKKP 64 residues in 1 query sequences 18511270 residues in 32554 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Mon Nov 7 15:33:16 2016 done: Mon Nov 7 15:33:17 2016 Total Scan time: 1.260 Total Display time: -0.020 Function used was FASTA [36.3.4 Apr, 2011]