FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE1201, 42 aa 1>>>pF1KE1201 42 - 42 aa - 42 aa Library: /omim/omim.rfq.tfa 60827320 residues in 85289 sequences Statistics: Expectation_n fit: rho(ln(x))= 3.9075+/-0.000203; mu= 10.8004+/- 0.013 mean_var=56.9614+/-11.380, 0's: 0 Z-trim(127.3): 30 B-trim: 555 in 1/57 Lambda= 0.169935 statistics sampled from 55477 (55510) to 55477 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.942), E-opt: 0.2 (0.651), width: 16 Scan time: 3.240 The best scores are: opt bits E(85289) NP_937861 (OMIM: 275355,601566) inhibitor of growt ( 210) 242 66.1 9.4e-12 NP_937860 (OMIM: 275355,601566) inhibitor of growt ( 235) 242 66.2 1e-11 NP_001254657 (OMIM: 275355,601566) inhibitor of gr ( 262) 242 66.2 1.1e-11 NP_937862 (OMIM: 275355,601566) inhibitor of growt ( 279) 242 66.3 1.1e-11 NP_005528 (OMIM: 275355,601566) inhibitor of growt ( 422) 242 66.5 1.5e-11 XP_011530229 (OMIM: 604215) PREDICTED: inhibitor o ( 225) 230 63.2 7.6e-11 NP_001278888 (OMIM: 604215) inhibitor of growth pr ( 240) 230 63.2 7.9e-11 NP_001555 (OMIM: 604215) inhibitor of growth prote ( 280) 230 63.3 8.7e-11 NP_115705 (OMIM: 608525) inhibitor of growth prote ( 240) 190 53.4 7.1e-08 XP_016860586 (OMIM: 608525) PREDICTED: inhibitor o ( 300) 190 53.5 8.2e-08 XP_016874882 (OMIM: 608524) PREDICTED: inhibitor o ( 196) 176 49.9 6.7e-07 XP_016874881 (OMIM: 608524) PREDICTED: inhibitor o ( 199) 176 49.9 6.7e-07 XP_005253755 (OMIM: 608524) PREDICTED: inhibitor o ( 200) 176 49.9 6.8e-07 XP_011519267 (OMIM: 608524) PREDICTED: inhibitor o ( 222) 176 50.0 7.2e-07 XP_011519266 (OMIM: 608524) PREDICTED: inhibitor o ( 224) 176 50.0 7.3e-07 NP_001121057 (OMIM: 608524) inhibitor of growth pr ( 225) 176 50.0 7.3e-07 NP_001121056 (OMIM: 608524) inhibitor of growth pr ( 245) 176 50.0 7.7e-07 NP_001121055 (OMIM: 608524) inhibitor of growth pr ( 246) 176 50.0 7.7e-07 NP_057246 (OMIM: 608524) inhibitor of growth prote ( 248) 176 50.0 7.8e-07 NP_001121054 (OMIM: 608524) inhibitor of growth pr ( 249) 176 50.0 7.8e-07 NP_061944 (OMIM: 607493) inhibitor of growth prote ( 418) 177 50.5 9.3e-07 NP_001317091 (OMIM: 608525) inhibitor of growth pr ( 226) 139 40.9 0.00039 XP_016860588 (OMIM: 608525) PREDICTED: inhibitor o ( 286) 139 41.0 0.00046 XP_016860587 (OMIM: 608525) PREDICTED: inhibitor o ( 286) 139 41.0 0.00046 >>NP_937861 (OMIM: 275355,601566) inhibitor of growth pr (210 aa) initn: 251 init1: 217 opt: 242 Z-score: 332.0 bits: 66.1 E(85289): 9.4e-12 Smith-Waterman score: 242; 76.9% identity (89.7% similar) in 39 aa overlap (1-38:154-192) 10 20 pF1KE1 MIRCDN-ECPIEWFRFSCVSLNHKPKRKWY :: ::: :::::::.::::.:::::: ::: NP_937 KAEREASPADLPIDPNEPTYCLCNQVSYGEMIGCDNDECPIEWFHFSCVGLNHKPKGKWY 130 140 150 160 170 180 30 40 pF1KE1 CSRCRGKNDGQSP : .:::.:. NP_937 CPKCRGENEKTMDKALEKSKKERAYNR 190 200 210 >>NP_937860 (OMIM: 275355,601566) inhibitor of growth pr (235 aa) initn: 251 init1: 217 opt: 242 Z-score: 331.4 bits: 66.2 E(85289): 1e-11 Smith-Waterman score: 242; 76.9% identity (89.7% similar) in 39 aa overlap (1-38:179-217) 10 20 pF1KE1 MIRCDN-ECPIEWFRFSCVSLNHKPKRKWY :: ::: :::::::.::::.:::::: ::: NP_937 KAEREASPADLPIDPNEPTYCLCNQVSYGEMIGCDNDECPIEWFHFSCVGLNHKPKGKWY 150 160 170 180 190 200 30 40 pF1KE1 CSRCRGKNDGQSP : .:::.:. NP_937 CPKCRGENEKTMDKALEKSKKERAYNR 210 220 230 >>NP_001254657 (OMIM: 275355,601566) inhibitor of growth (262 aa) initn: 251 init1: 217 opt: 242 Z-score: 330.9 bits: 66.2 E(85289): 1.1e-11 Smith-Waterman score: 242; 76.9% identity (89.7% similar) in 39 aa overlap (1-38:206-244) 10 20 pF1KE1 MIRCDN-ECPIEWFRFSCVSLNHKPKRKWY :: ::: :::::::.::::.:::::: ::: NP_001 KAEREASPADLPIDPNEPTYCLCNQVSYGEMIGCDNDECPIEWFHFSCVGLNHKPKGKWY 180 190 200 210 220 230 30 40 pF1KE1 CSRCRGKNDGQSP : .:::.:. NP_001 CPKCRGENEKTMDKALEKSKKERAYNR 240 250 260 >>NP_937862 (OMIM: 275355,601566) inhibitor of growth pr (279 aa) initn: 251 init1: 217 opt: 242 Z-score: 330.5 bits: 66.3 E(85289): 1.1e-11 Smith-Waterman score: 242; 76.9% identity (89.7% similar) in 39 aa overlap (1-38:223-261) 10 20 pF1KE1 MIRCDN-ECPIEWFRFSCVSLNHKPKRKWY :: ::: :::::::.::::.:::::: ::: NP_937 KAEREASPADLPIDPNEPTYCLCNQVSYGEMIGCDNDECPIEWFHFSCVGLNHKPKGKWY 200 210 220 230 240 250 30 40 pF1KE1 CSRCRGKNDGQSP : .:::.:. NP_937 CPKCRGENEKTMDKALEKSKKERAYNR 260 270 >>NP_005528 (OMIM: 275355,601566) inhibitor of growth pr (422 aa) initn: 254 init1: 217 opt: 242 Z-score: 328.4 bits: 66.5 E(85289): 1.5e-11 Smith-Waterman score: 242; 76.9% identity (89.7% similar) in 39 aa overlap (1-38:366-404) 10 20 pF1KE1 MIRCDN-ECPIEWFRFSCVSLNHKPKRKWY :: ::: :::::::.::::.:::::: ::: NP_005 KAEREASPADLPIDPNEPTYCLCNQVSYGEMIGCDNDECPIEWFHFSCVGLNHKPKGKWY 340 350 360 370 380 390 30 40 pF1KE1 CSRCRGKNDGQSP : .:::.:. NP_005 CPKCRGENEKTMDKALEKSKKERAYNR 400 410 420 >>XP_011530229 (OMIM: 604215) PREDICTED: inhibitor of gr (225 aa) initn: 237 init1: 199 opt: 230 Z-score: 315.7 bits: 63.2 E(85289): 7.6e-11 Smith-Waterman score: 230; 74.4% identity (87.2% similar) in 39 aa overlap (1-38:170-208) 10 20 pF1KE1 MIRCDNE-CPIEWFRFSCVSLNHKPKRKWY :: :::: ::::::.::::::..::: ::: XP_011 KQEREASPVEFAIDPNEPTYCLCNQVSYGEMIGCDNEQCPIEWFHFSCVSLTYKPKGKWY 140 150 160 170 180 190 30 40 pF1KE1 CSRCRGKNDGQSP : .::: :. XP_011 CPKCRGDNEKTMDKSTEKTKKDRRSR 200 210 220 >>NP_001278888 (OMIM: 604215) inhibitor of growth protei (240 aa) initn: 237 init1: 199 opt: 230 Z-score: 315.4 bits: 63.2 E(85289): 7.9e-11 Smith-Waterman score: 230; 74.4% identity (87.2% similar) in 39 aa overlap (1-38:185-223) 10 20 pF1KE1 MIRCDNE-CPIEWFRFSCVSLNHKPKRKWY :: :::: ::::::.::::::..::: ::: NP_001 KQEREASPVEFAIDPNEPTYCLCNQVSYGEMIGCDNEQCPIEWFHFSCVSLTYKPKGKWY 160 170 180 190 200 210 30 40 pF1KE1 CSRCRGKNDGQSP : .::: :. NP_001 CPKCRGDNEKTMDKSTEKTKKDRRSR 220 230 240 >>NP_001555 (OMIM: 604215) inhibitor of growth protein 2 (280 aa) initn: 237 init1: 199 opt: 230 Z-score: 314.6 bits: 63.3 E(85289): 8.7e-11 Smith-Waterman score: 230; 74.4% identity (87.2% similar) in 39 aa overlap (1-38:225-263) 10 20 pF1KE1 MIRCDNE-CPIEWFRFSCVSLNHKPKRKWY :: :::: ::::::.::::::..::: ::: NP_001 KQEREASPVEFAIDPNEPTYCLCNQVSYGEMIGCDNEQCPIEWFHFSCVSLTYKPKGKWY 200 210 220 230 240 250 30 40 pF1KE1 CSRCRGKNDGQSP : .::: :. NP_001 CPKCRGDNEKTMDKSTEKTKKDRRSR 260 270 280 >>NP_115705 (OMIM: 608525) inhibitor of growth protein 5 (240 aa) initn: 188 init1: 165 opt: 190 Z-score: 262.4 bits: 53.4 E(85289): 7.1e-08 Smith-Waterman score: 190; 67.6% identity (85.3% similar) in 34 aa overlap (1-33:199-232) 10 20 pF1KE1 MIRCDN-ECPIEWFRFSCVSLNHKPKRKWY :: ::: .::::::.:.::.:. ::: ::. NP_115 LSVHPSDVLDMPVDPNEPTYCLCHQVSYGEMIGCDNPDCPIEWFHFACVDLTTKPKGKWF 170 180 190 200 210 220 30 40 pF1KE1 CSRCRGKNDGQSP : :: NP_115 CPRCVQEKRKKK 230 240 >>XP_016860586 (OMIM: 608525) PREDICTED: inhibitor of gr (300 aa) initn: 188 init1: 165 opt: 190 Z-score: 261.3 bits: 53.5 E(85289): 8.2e-08 Smith-Waterman score: 190; 67.6% identity (85.3% similar) in 34 aa overlap (1-33:259-292) 10 20 pF1KE1 MIRCDN-ECPIEWFRFSCVSLNHKPKRKWY :: ::: .::::::.:.::.:. ::: ::. XP_016 LSVHPSDVLDMPVDPNEPTYCLCHQVSYGEMIGCDNPDCPIEWFHFACVDLTTKPKGKWF 230 240 250 260 270 280 30 40 pF1KE1 CSRCRGKNDGQSP : :: XP_016 CPRCVQEKRKKK 290 300 42 residues in 1 query sequences 60827320 residues in 85289 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Sun Nov 6 21:45:09 2016 done: Sun Nov 6 21:45:10 2016 Total Scan time: 3.240 Total Display time: 0.020 Function used was FASTA [36.3.4 Apr, 2011]