FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE1561, 98 aa 1>>>pF1KE1561 98 - 98 aa - 98 aa Library: human.CCDS.faa 18511270 residues in 32554 sequences Statistics: Expectation_n fit: rho(ln(x))= 4.3623+/-0.000481; mu= 14.3552+/- 0.029 mean_var=53.9724+/-10.562, 0's: 0 Z-trim(114.9): 46 B-trim: 0 in 0/51 Lambda= 0.174577 statistics sampled from 15386 (15436) to 15386 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.837), E-opt: 0.2 (0.474), width: 16 Scan time: 1.550 The best scores are: opt bits E(32554) CCDS6570.1 CCL19 gene_id:6363|Hs108|chr9 ( 98) 665 174.0 1.3e-44 CCDS6571.1 CCL21 gene_id:6366|Hs108|chr9 ( 134) 231 64.8 1.4e-11 >>CCDS6570.1 CCL19 gene_id:6363|Hs108|chr9 (98 aa) initn: 665 init1: 665 opt: 665 Z-score: 914.2 bits: 174.0 E(32554): 1.3e-44 Smith-Waterman score: 665; 100.0% identity (100.0% similar) in 98 aa overlap (1-98:1-98) 10 20 30 40 50 60 pF1KE1 MALLLALSLLVLWTSPAPTLSGTNDAEDCCLSVTQKPIPGYIVRNFHYLLIKDGCRVPAV :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS65 MALLLALSLLVLWTSPAPTLSGTNDAEDCCLSVTQKPIPGYIVRNFHYLLIKDGCRVPAV 10 20 30 40 50 60 70 80 90 pF1KE1 VFTTLRGRQLCAPPDQPWVERIIQRLQRTSAKMKRRSS :::::::::::::::::::::::::::::::::::::: CCDS65 VFTTLRGRQLCAPPDQPWVERIIQRLQRTSAKMKRRSS 70 80 90 >>CCDS6571.1 CCL21 gene_id:6366|Hs108|chr9 (134 aa) initn: 231 init1: 132 opt: 231 Z-score: 321.6 bits: 64.8 E(32554): 1.4e-11 Smith-Waterman score: 231; 37.8% identity (67.3% similar) in 98 aa overlap (1-94:1-98) 10 20 30 40 50 pF1KE1 MALLLALSLLVLWTS-PAPTLSGTND-AEDCCLSVTQKPIPGYIVRNFHYLLIKDGCRVP :: ::::::.: . : .:.. :.::::. .:. ::. .::... . :: .: CCDS65 MAQSLALSLLILVLAFGIPRTQGSDGGAQDCCLKYSQRKIPAKVVRSYRKQEPSLGCSIP 10 20 30 40 50 60 60 70 80 90 pF1KE1 AVVFTTLRGRQ--LCAPPDQPWVERIIQRLQRTSAKMKRRSS :..: . : ::: : . ::....:.:..: . .: CCDS65 AILFLPRKRSQAELCADPKELWVQQLMQHLDKTPSPQKPAQGCRKDRGASKTGKKGKGSK 70 80 90 100 110 120 CCDS65 GCKRTERSQTPKGP 130 98 residues in 1 query sequences 18511270 residues in 32554 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Sun Nov 6 22:34:17 2016 done: Sun Nov 6 22:34:17 2016 Total Scan time: 1.550 Total Display time: -0.020 Function used was FASTA [36.3.4 Apr, 2011]