FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE2572, 125 aa 1>>>pF1KE2572 125 - 125 aa - 125 aa Library: /omim/omim.rfq.tfa 60827320 residues in 85289 sequences Statistics: Expectation_n fit: rho(ln(x))= 5.1768+/-0.000395; mu= 9.8888+/- 0.024 mean_var=44.0441+/- 9.071, 0's: 0 Z-trim(109.9): 30 B-trim: 0 in 0/53 Lambda= 0.193255 statistics sampled from 18160 (18170) to 18160 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.589), E-opt: 0.2 (0.213), width: 16 Scan time: 4.250 The best scores are: opt bits E(85289) NP_054736 (OMIM: 610389,610798) ragulator complex ( 125) 790 227.5 4.3e-60 NP_001138736 (OMIM: 610389,610798) ragulator compl ( 95) 496 145.6 1.5e-35 >>NP_054736 (OMIM: 610389,610798) ragulator complex prot (125 aa) initn: 790 init1: 790 opt: 790 Z-score: 1199.9 bits: 227.5 E(85289): 4.3e-60 Smith-Waterman score: 790; 100.0% identity (100.0% similar) in 125 aa overlap (1-125:1-125) 10 20 30 40 50 60 pF1KE2 MLRPKALTQVLSQANTGGVQSTLLLNNEGSLLAYSGYGDTDARVTAAIASNIWAAYDRNG :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_054 MLRPKALTQVLSQANTGGVQSTLLLNNEGSLLAYSGYGDTDARVTAAIASNIWAAYDRNG 10 20 30 40 50 60 70 80 90 100 110 120 pF1KE2 NQAFNEDNLKFILMDCMEGRVAITRVANLLLCMYAKETVGFGMLKAKAQALVQYLEEPLT :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_054 NQAFNEDNLKFILMDCMEGRVAITRVANLLLCMYAKETVGFGMLKAKAQALVQYLEEPLT 70 80 90 100 110 120 pF1KE2 QVAAS ::::: NP_054 QVAAS >>NP_001138736 (OMIM: 610389,610798) ragulator complex p (95 aa) initn: 496 init1: 496 opt: 496 Z-score: 759.0 bits: 145.6 E(85289): 1.5e-35 Smith-Waterman score: 532; 76.0% identity (76.0% similar) in 125 aa overlap (1-125:1-95) 10 20 30 40 50 60 pF1KE2 MLRPKALTQVLSQANTGGVQSTLLLNNEGSLLAYSGYGDTDARVTAAIASNIWAAYDRNG :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_001 MLRPKALTQVLSQANTGGVQSTLLLNNEGSLLAYSGYGDTDARVTAAIASNIWAAYDRNG 10 20 30 40 50 60 70 80 90 100 110 120 pF1KE2 NQAFNEDNLKFILMDCMEGRVAITRVANLLLCMYAKETVGFGMLKAKAQALVQYLEEPLT ::::::::::::::::: ::::::::::::: NP_001 NQAFNEDNLKFILMDCM------------------------------AQALVQYLEEPLT 70 80 90 pF1KE2 QVAAS ::::: NP_001 QVAAS 125 residues in 1 query sequences 60827320 residues in 85289 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Sat Nov 5 06:05:19 2016 done: Sat Nov 5 06:05:19 2016 Total Scan time: 4.250 Total Display time: -0.020 Function used was FASTA [36.3.4 Apr, 2011]