FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE5124, 84 aa 1>>>pF1KE5124 84 - 84 aa - 84 aa Library: /omim/omim.rfq.tfa 60827320 residues in 85289 sequences Statistics: Expectation_n fit: rho(ln(x))= 4.7234+/-0.000272; mu= 11.6397+/- 0.017 mean_var=62.4912+/-12.441, 0's: 0 Z-trim(119.8): 80 B-trim: 28 in 1/53 Lambda= 0.162243 statistics sampled from 34131 (34220) to 34131 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.783), E-opt: 0.2 (0.401), width: 16 Scan time: 3.630 The best scores are: opt bits E(85289) NP_066937 (OMIM: 605753) serine protease inhibitor ( 84) 587 144.7 1.7e-35 NP_001258649 (OMIM: 605753) serine protease inhibi ( 119) 490 122.1 1.5e-28 NP_001258647 (OMIM: 605753) serine protease inhibi ( 134) 490 122.2 1.6e-28 XP_011532707 (OMIM: 605753) PREDICTED: serine prot ( 186) 393 99.6 1.4e-21 NP_003113 (OMIM: 167790,167800,608189) serine prot ( 79) 180 49.4 7.5e-07 NP_001035523 (OMIM: 613511) serine protease inhibi ( 86) 169 46.9 4.8e-06 NP_995313 (OMIM: 615868) serine protease inhibitor ( 80) 163 45.4 1.2e-05 NP_001182219 (OMIM: 615868) serine protease inhibi ( 80) 163 45.4 1.2e-05 NP_055286 (OMIM: 613929) serine protease inhibitor ( 86) 162 45.2 1.5e-05 XP_016865198 (OMIM: 613511) PREDICTED: serine prot ( 107) 157 44.1 3.9e-05 NP_001035218 (OMIM: 615205) serine protease inhibi ( 94) 143 40.8 0.00035 NP_006837 (OMIM: 147050,256500,605010) serine prot (1064) 145 42.1 0.0016 XP_011535853 (OMIM: 147050,256500,605010) PREDICTE (1066) 145 42.1 0.0016 NP_001121170 (OMIM: 147050,256500,605010) serine p (1094) 145 42.1 0.0016 XP_011539731 (OMIM: 103320,615120) PREDICTED: agri (2004) 140 41.2 0.0059 NP_940978 (OMIM: 103320,615120) agrin isoform 2 pr (2045) 140 41.2 0.006 XP_005244806 (OMIM: 103320,615120) PREDICTED: agri (2049) 140 41.2 0.006 NP_001292204 (OMIM: 103320,615120) agrin isoform 1 (2068) 140 41.2 0.006 >>NP_066937 (OMIM: 605753) serine protease inhibitor Kaz (84 aa) initn: 587 init1: 587 opt: 587 Z-score: 758.5 bits: 144.7 E(85289): 1.7e-35 Smith-Waterman score: 587; 100.0% identity (100.0% similar) in 84 aa overlap (1-84:1-84) 10 20 30 40 50 60 pF1KE5 MALSVLRLALLLLAVTFAASLIPQFGLFSKYRTPNCSQYRLPGCPRHFNPVCGSDMSTYA :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_066 MALSVLRLALLLLAVTFAASLIPQFGLFSKYRTPNCSQYRLPGCPRHFNPVCGSDMSTYA 10 20 30 40 50 60 70 80 pF1KE5 NECTLCMKIREGGHNIKIIRNGPC :::::::::::::::::::::::: NP_066 NECTLCMKIREGGHNIKIIRNGPC 70 80 >>NP_001258649 (OMIM: 605753) serine protease inhibitor (119 aa) initn: 578 init1: 490 opt: 490 Z-score: 633.7 bits: 122.1 E(85289): 1.5e-28 Smith-Waterman score: 490; 100.0% identity (100.0% similar) in 66 aa overlap (19-84:54-119) 10 20 30 40 pF1KE5 MALSVLRLALLLLAVTFAASLIPQFGLFSKYRTPNCSQYRLPGCPRHF :::::::::::::::::::::::::::::: NP_001 GPGERGPPEKSGFGSQTGGGPCPAPGGLGDASLIPQFGLFSKYRTPNCSQYRLPGCPRHF 30 40 50 60 70 80 50 60 70 80 pF1KE5 NPVCGSDMSTYANECTLCMKIREGGHNIKIIRNGPC :::::::::::::::::::::::::::::::::::: NP_001 NPVCGSDMSTYANECTLCMKIREGGHNIKIIRNGPC 90 100 110 >>NP_001258647 (OMIM: 605753) serine protease inhibitor (134 aa) initn: 578 init1: 490 opt: 490 Z-score: 633.0 bits: 122.2 E(85289): 1.6e-28 Smith-Waterman score: 490; 100.0% identity (100.0% similar) in 66 aa overlap (19-84:69-134) 10 20 30 40 pF1KE5 MALSVLRLALLLLAVTFAASLIPQFGLFSKYRTPNCSQYRLPGCPRHF :::::::::::::::::::::::::::::: NP_001 QTGGGPCPAPGGLGDGTRAPVTGGSPEDLPASLIPQFGLFSKYRTPNCSQYRLPGCPRHF 40 50 60 70 80 90 50 60 70 80 pF1KE5 NPVCGSDMSTYANECTLCMKIREGGHNIKIIRNGPC :::::::::::::::::::::::::::::::::::: NP_001 NPVCGSDMSTYANECTLCMKIREGGHNIKIIRNGPC 100 110 120 130 >>XP_011532707 (OMIM: 605753) PREDICTED: serine protease (186 aa) initn: 405 init1: 393 opt: 393 Z-score: 508.3 bits: 99.6 E(85289): 1.4e-21 Smith-Waterman score: 393; 100.0% identity (100.0% similar) in 51 aa overlap (34-84:136-186) 10 20 30 40 50 60 pF1KE5 SVLRLALLLLAVTFAASLIPQFGLFSKYRTPNCSQYRLPGCPRHFNPVCGSDMSTYANEC :::::::::::::::::::::::::::::: XP_011 DRRGKTAGAGGGWRCRCCAWRCCSWQLPSQPNCSQYRLPGCPRHFNPVCGSDMSTYANEC 110 120 130 140 150 160 70 80 pF1KE5 TLCMKIREGGHNIKIIRNGPC ::::::::::::::::::::: XP_011 TLCMKIREGGHNIKIIRNGPC 170 180 >>NP_003113 (OMIM: 167790,167800,608189) serine protease (79 aa) initn: 184 init1: 167 opt: 180 Z-score: 244.0 bits: 49.4 E(85289): 7.5e-07 Smith-Waterman score: 180; 38.7% identity (65.3% similar) in 75 aa overlap (10-84:6-79) 10 20 30 40 50 60 pF1KE5 MALSVLRLALLLLAVTFAASLIPQFGLFSKYRTPNCSQYRLPGCPRHFNPVCGSDMSTYA ..::.. :: . : : : .: . .: :: . ..::::.: .:: NP_003 MKVTGIFLLSALALLSLSGNTGADSLGREAKCYN-ELNGCTKIYDPVCGTDGNTYP 10 20 30 40 50 70 80 pF1KE5 NECTLCMKIREGGHNIKIIRNGPC :::.::.. :. .: : ..::: NP_003 NECVLCFENRKRQTSILIQKSGPC 60 70 >>NP_001035523 (OMIM: 613511) serine protease inhibitor (86 aa) initn: 146 init1: 119 opt: 169 Z-score: 229.6 bits: 46.9 E(85289): 4.8e-06 Smith-Waterman score: 169; 33.3% identity (66.7% similar) in 81 aa overlap (10-84:7-86) 10 20 30 40 50 pF1KE5 MALSVLRLALLLLAVTFAASLIPQFGLFSKYRTPNCSQYRL--PG----CPRHFNPVCGS .::::.:.:. . . . .: . .::.:. :: : . ..:.::: NP_001 MRATAIVLLLALTLATMFSIECAKQTK-QMVDCSHYKKLPPGQQRFCHHMYDPICGS 10 20 30 40 50 60 70 80 pF1KE5 DMSTYANECTLCMKIREGGHNIKIIRNGPC : .:: :.: .: :... ..:... : : NP_001 DGKTYKNDCFFCSKVKKTDGTLKFVHFGKC 60 70 80 >>NP_995313 (OMIM: 615868) serine protease inhibitor Kaz (80 aa) initn: 120 init1: 105 opt: 163 Z-score: 222.4 bits: 45.4 E(85289): 1.2e-05 Smith-Waterman score: 163; 32.1% identity (66.7% similar) in 81 aa overlap (6-84:1-80) 10 20 30 40 50 pF1KE5 MALSVLRLALLLLAVTFAASLIPQFGLFSKYRTPNCSQYRLPG--CPRHFNPVCGSDMST ..:. ..: ...: . :.::. .:.... : : :. :: :::: .: NP_995 MKLSGMFLLLSLAL-FCFLTGVFSQGGQVDCGEFQDPKVYCTRESNPHCGSDGQT 10 20 30 40 50 60 70 80 pF1KE5 YANECTLCMKIREGGHNIKIIRNGPC :.:.:..: : ..: .:.. . : : NP_995 YGNKCAFCKAIVKSGGKISLKHPGKC 60 70 80 >>NP_001182219 (OMIM: 615868) serine protease inhibitor (80 aa) initn: 120 init1: 105 opt: 163 Z-score: 222.4 bits: 45.4 E(85289): 1.2e-05 Smith-Waterman score: 163; 32.1% identity (66.7% similar) in 81 aa overlap (6-84:1-80) 10 20 30 40 50 pF1KE5 MALSVLRLALLLLAVTFAASLIPQFGLFSKYRTPNCSQYRLPG--CPRHFNPVCGSDMST ..:. ..: ...: . :.::. .:.... : : :. :: :::: .: NP_001 MKLSGMFLLLSLAL-FCFLTGVFSQGGQVDCGEFQDPKVYCTRESNPHCGSDGQT 10 20 30 40 50 60 70 80 pF1KE5 YANECTLCMKIREGGHNIKIIRNGPC :.:.:..: : ..: .:.. . : : NP_001 YGNKCAFCKAIVKSGGKISLKHPGKC 60 70 80 >>NP_055286 (OMIM: 613929) serine protease inhibitor Kaz (86 aa) initn: 121 init1: 89 opt: 162 Z-score: 220.7 bits: 45.2 E(85289): 1.5e-05 Smith-Waterman score: 162; 33.7% identity (57.0% similar) in 86 aa overlap (1-84:1-86) 10 20 30 40 50 pF1KE5 MALSVLRLALLLLAVTFAASLIP-QFGLFSKYRTPNCSQY-RLPGCPRHFNPVCGSDMST ::. .:: : :. . .: : . : : : .. . : : . : :::.: : NP_055 MAVRQWVIALALAALLVVDREVPVAAGKLPFSRMPICEHMVESPTCSQMSNLVCGTDGLT 10 20 30 40 50 60 60 70 80 pF1KE5 YANECTLCMKIREGGHNIKIIRNGPC :.::: ::. . ..:.:...: : NP_055 YTNECQLCLARIKTKQDIQIMKDGKC 70 80 >>XP_016865198 (OMIM: 613511) PREDICTED: serine protease (107 aa) initn: 113 init1: 89 opt: 157 Z-score: 213.1 bits: 44.1 E(85289): 3.9e-05 Smith-Waterman score: 157; 35.7% identity (67.9% similar) in 56 aa overlap (35-84:52-107) 10 20 30 40 50 pF1KE5 VLRLALLLLAVTFAASLIPQFGLFSKYRTPNCSQYRL--PG----CPRHFNPVCGSDMST .::.:. :: : . ..:.:::: .: XP_016 EHNEPRRLMGLTQPEHLQGIECAKQTKQMVDCSHYKKLPPGQQRFCHHMYDPICGSDGKT 30 40 50 60 70 80 60 70 80 pF1KE5 YANECTLCMKIREGGHNIKIIRNGPC : :.: .: :... ..:... : : XP_016 YKNDCFFCSKVKKTDGTLKFVHFGKC 90 100 84 residues in 1 query sequences 60827320 residues in 85289 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Mon Nov 7 21:37:58 2016 done: Mon Nov 7 21:37:58 2016 Total Scan time: 3.630 Total Display time: -0.020 Function used was FASTA [36.3.4 Apr, 2011]