FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE5124, 84 aa 1>>>pF1KE5124 84 - 84 aa - 84 aa Library: human.CCDS.faa 18511270 residues in 32554 sequences Statistics: Expectation_n fit: rho(ln(x))= 4.7035+/-0.000552; mu= 11.6579+/- 0.033 mean_var=60.2086+/-11.957, 0's: 0 Z-trim(113.3): 51 B-trim: 115 in 2/49 Lambda= 0.165289 statistics sampled from 13919 (13970) to 13919 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.802), E-opt: 0.2 (0.429), width: 16 Scan time: 1.400 The best scores are: opt bits E(32554) CCDS3508.1 SPINK2 gene_id:6691|Hs108|chr4 ( 84) 587 147.1 1.2e-36 CCDS63972.1 SPINK2 gene_id:6691|Hs108|chr4 ( 119) 490 124.0 1.5e-29 CCDS63971.1 SPINK2 gene_id:6691|Hs108|chr4 ( 134) 490 124.1 1.6e-29 >>CCDS3508.1 SPINK2 gene_id:6691|Hs108|chr4 (84 aa) initn: 587 init1: 587 opt: 587 Z-score: 771.2 bits: 147.1 E(32554): 1.2e-36 Smith-Waterman score: 587; 100.0% identity (100.0% similar) in 84 aa overlap (1-84:1-84) 10 20 30 40 50 60 pF1KE5 MALSVLRLALLLLAVTFAASLIPQFGLFSKYRTPNCSQYRLPGCPRHFNPVCGSDMSTYA :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS35 MALSVLRLALLLLAVTFAASLIPQFGLFSKYRTPNCSQYRLPGCPRHFNPVCGSDMSTYA 10 20 30 40 50 60 70 80 pF1KE5 NECTLCMKIREGGHNIKIIRNGPC :::::::::::::::::::::::: CCDS35 NECTLCMKIREGGHNIKIIRNGPC 70 80 >>CCDS63972.1 SPINK2 gene_id:6691|Hs108|chr4 (119 aa) initn: 578 init1: 490 opt: 490 Z-score: 644.1 bits: 124.0 E(32554): 1.5e-29 Smith-Waterman score: 490; 100.0% identity (100.0% similar) in 66 aa overlap (19-84:54-119) 10 20 30 40 pF1KE5 MALSVLRLALLLLAVTFAASLIPQFGLFSKYRTPNCSQYRLPGCPRHF :::::::::::::::::::::::::::::: CCDS63 GPGERGPPEKSGFGSQTGGGPCPAPGGLGDASLIPQFGLFSKYRTPNCSQYRLPGCPRHF 30 40 50 60 70 80 50 60 70 80 pF1KE5 NPVCGSDMSTYANECTLCMKIREGGHNIKIIRNGPC :::::::::::::::::::::::::::::::::::: CCDS63 NPVCGSDMSTYANECTLCMKIREGGHNIKIIRNGPC 90 100 110 >>CCDS63971.1 SPINK2 gene_id:6691|Hs108|chr4 (134 aa) initn: 578 init1: 490 opt: 490 Z-score: 643.4 bits: 124.1 E(32554): 1.6e-29 Smith-Waterman score: 490; 100.0% identity (100.0% similar) in 66 aa overlap (19-84:69-134) 10 20 30 40 pF1KE5 MALSVLRLALLLLAVTFAASLIPQFGLFSKYRTPNCSQYRLPGCPRHF :::::::::::::::::::::::::::::: CCDS63 QTGGGPCPAPGGLGDGTRAPVTGGSPEDLPASLIPQFGLFSKYRTPNCSQYRLPGCPRHF 40 50 60 70 80 90 50 60 70 80 pF1KE5 NPVCGSDMSTYANECTLCMKIREGGHNIKIIRNGPC :::::::::::::::::::::::::::::::::::: CCDS63 NPVCGSDMSTYANECTLCMKIREGGHNIKIIRNGPC 100 110 120 130 84 residues in 1 query sequences 18511270 residues in 32554 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Mon Nov 7 21:37:57 2016 done: Mon Nov 7 21:37:57 2016 Total Scan time: 1.400 Total Display time: -0.030 Function used was FASTA [36.3.4 Apr, 2011]