FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE5115, 106 aa 1>>>pF1KE5115 106 - 106 aa - 106 aa Library: human.CCDS.faa 18511270 residues in 32554 sequences Statistics: Expectation_n fit: rho(ln(x))= 4.8244+/-0.000624; mu= 12.3485+/- 0.038 mean_var=56.6726+/-11.305, 0's: 0 Z-trim(110.7): 15 B-trim: 0 in 0/51 Lambda= 0.170368 statistics sampled from 11806 (11818) to 11806 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.755), E-opt: 0.2 (0.363), width: 16 Scan time: 1.390 The best scores are: opt bits E(32554) CCDS4078.1 GLRX gene_id:2745|Hs108|chr5 ( 106) 707 181.0 1.2e-46 >>CCDS4078.1 GLRX gene_id:2745|Hs108|chr5 (106 aa) initn: 707 init1: 707 opt: 707 Z-score: 950.8 bits: 181.0 E(32554): 1.2e-46 Smith-Waterman score: 707; 100.0% identity (100.0% similar) in 106 aa overlap (1-106:1-106) 10 20 30 40 50 60 pF1KE5 MAQEFVNCKIQPGKVVVFIKPTCPYCRRAQEILSQLPIKQGLLEFVDITATNHTNEIQDY :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS40 MAQEFVNCKIQPGKVVVFIKPTCPYCRRAQEILSQLPIKQGLLEFVDITATNHTNEIQDY 10 20 30 40 50 60 70 80 90 100 pF1KE5 LQQLTGARTVPRVFIGKDCIGGCSDLVSLQQSGELLTRLKQIGALQ :::::::::::::::::::::::::::::::::::::::::::::: CCDS40 LQQLTGARTVPRVFIGKDCIGGCSDLVSLQQSGELLTRLKQIGALQ 70 80 90 100 106 residues in 1 query sequences 18511270 residues in 32554 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Mon Nov 7 21:29:08 2016 done: Mon Nov 7 21:29:08 2016 Total Scan time: 1.390 Total Display time: -0.040 Function used was FASTA [36.3.4 Apr, 2011]