FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KE1356, 91 aa
  1>>>pF1KE1356 91 - 91 aa - 91 aa
Library: human.CCDS.faa
  18511270 residues in 32554 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 4.6879+/-0.000543; mu= 12.6512+/- 0.033
 mean_var=60.4632+/-11.944, 0's: 0 Z-trim(112.9): 9  B-trim: 0 in 0/52
 Lambda= 0.164941
 statistics sampled from 13547 (13555) to 13547 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.803), E-opt: 0.2 (0.416), width:  16
 Scan time:  1.480

The best scores are:                                      opt bits E(32554)
CCDS8020.1 SCGB1A1 gene_id:7356|Hs108|chr11        (  91)  577 144.4 9.3e-36


>>CCDS8020.1 SCGB1A1 gene_id:7356|Hs108|chr11             (91 aa)
 initn: 577 init1: 577 opt: 577  Z-score: 755.4  bits: 144.4 E(32554): 9.3e-36
Smith-Waterman score: 577; 100.0% identity (100.0% similar) in 91 aa overlap (1-91:1-91)

               10        20        30        40        50        60
pF1KE1 MKLAVTLTLVTLALCCSSASAEICPSFQRVIETLLMDTPSSYEAAMELFSPDQDMREAGA
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS80 MKLAVTLTLVTLALCCSSASAEICPSFQRVIETLLMDTPSSYEAAMELFSPDQDMREAGA
               10        20        30        40        50        60

               70        80        90 
pF1KE1 QLKKLVDTLPQKPRESIIKLMEKIAQSSLCN
       :::::::::::::::::::::::::::::::
CCDS80 QLKKLVDTLPQKPRESIIKLMEKIAQSSLCN
               70        80        90 




91 residues in 1 query   sequences
18511270 residues in 32554 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Sun Nov  6 23:18:11 2016 done: Sun Nov  6 23:18:11 2016
 Total Scan time:  1.480 Total Display time: -0.020

Function used was FASTA [36.3.4 Apr, 2011]