FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE5203, 220 aa 1>>>pF1KE5203 220 - 220 aa - 220 aa Library: human.CCDS.faa 18511270 residues in 32554 sequences Statistics: Expectation_n fit: rho(ln(x))= 5.8338+/-0.000798; mu= 11.9298+/- 0.048 mean_var=78.8494+/-15.341, 0's: 0 Z-trim(108.2): 11 B-trim: 9 in 1/51 Lambda= 0.144436 statistics sampled from 10040 (10044) to 10040 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.696), E-opt: 0.2 (0.309), width: 16 Scan time: 1.950 The best scores are: opt bits E(32554) CCDS12416.1 POP4 gene_id:10775|Hs108|chr19 ( 220) 1426 306.2 1.1e-83 >>CCDS12416.1 POP4 gene_id:10775|Hs108|chr19 (220 aa) initn: 1426 init1: 1426 opt: 1426 Z-score: 1616.2 bits: 306.2 E(32554): 1.1e-83 Smith-Waterman score: 1426; 100.0% identity (100.0% similar) in 220 aa overlap (1-220:1-220) 10 20 30 40 50 60 pF1KE5 MKSVIYHALSQKEANDSDVQPSGAQRAEAFVRAFLKRSTPRMSPQAREDQLQRKAVVLEY :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS12 MKSVIYHALSQKEANDSDVQPSGAQRAEAFVRAFLKRSTPRMSPQAREDQLQRKAVVLEY 10 20 30 40 50 60 70 80 90 100 110 120 pF1KE5 FTRHKRKEKKKKAKGLSARQRRELRLFDIKPEQQRYSLFLPLHELWKQYIRDLCSGLKPD :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS12 FTRHKRKEKKKKAKGLSARQRRELRLFDIKPEQQRYSLFLPLHELWKQYIRDLCSGLKPD 70 80 90 100 110 120 130 140 150 160 170 180 pF1KE5 TQPQMIQAKLLKADLHGAIISVTKSKCPSYVGITGILLQETKHIFKIITKEDRLKVIPKL :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS12 TQPQMIQAKLLKADLHGAIISVTKSKCPSYVGITGILLQETKHIFKIITKEDRLKVIPKL 130 140 150 160 170 180 190 200 210 220 pF1KE5 NCVFTVETDGFISYIYGSKFQLRSSERSAKKFKAKGTIDL :::::::::::::::::::::::::::::::::::::::: CCDS12 NCVFTVETDGFISYIYGSKFQLRSSERSAKKFKAKGTIDL 190 200 210 220 220 residues in 1 query sequences 18511270 residues in 32554 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Mon Nov 7 22:29:03 2016 done: Mon Nov 7 22:29:04 2016 Total Scan time: 1.950 Total Display time: -0.020 Function used was FASTA [36.3.4 Apr, 2011]