Result of FASTA (ccds) for pFN21AE6148
FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KE6148, 102 aa
  1>>>pF1KE6148 102 - 102 aa - 102 aa
Library: human.CCDS.faa
  18511270 residues in 32554 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 4.8202+/-0.000496; mu= 12.8373+/- 0.030
 mean_var=59.3713+/-11.620, 0's: 0 Z-trim(114.9): 6  B-trim: 0 in 0/53
 Lambda= 0.166451
 statistics sampled from 15461 (15464) to 15461 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.833), E-opt: 0.2 (0.475), width:  16
 Scan time:  1.440

The best scores are:                                      opt bits E(32554)
CCDS10716.1 AHSP gene_id:51327|Hs108|chr16         ( 102)  673 168.4 6.7e-43


>>CCDS10716.1 AHSP gene_id:51327|Hs108|chr16              (102 aa)
 initn: 673 init1: 673 opt: 673  Z-score: 883.6  bits: 168.4 E(32554): 6.7e-43
Smith-Waterman score: 673; 100.0% identity (100.0% similar) in 102 aa overlap (1-102:1-102)

               10        20        30        40        50        60
pF1KE6 MALLKANKDLISAGLKEFSVLLNQQVFNDPLVSEEDMVTVVEDWMNFYINYYRQQVTGEP
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS10 MALLKANKDLISAGLKEFSVLLNQQVFNDPLVSEEDMVTVVEDWMNFYINYYRQQVTGEP
               10        20        30        40        50        60

               70        80        90       100  
pF1KE6 QERDKALQELRQELNTLANPFLAKYRDFLKSHELPSHPPPSS
       ::::::::::::::::::::::::::::::::::::::::::
CCDS10 QERDKALQELRQELNTLANPFLAKYRDFLKSHELPSHPPPSS
               70        80        90       100  




102 residues in 1 query   sequences
18511270 residues in 32554 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Tue Nov  8 09:52:26 2016 done: Tue Nov  8 09:52:27 2016
 Total Scan time:  1.440 Total Display time: -0.030

Function used was FASTA [36.3.4 Apr, 2011]
Inquiries or Suggestions ?
Send a message to flexiclone AT kazusagt.com