Result of FASTA (omim) for pFN21AE3647
FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KE3647, 99 aa
  1>>>pF1KE3647 99 - 99 aa - 99 aa
Library: /omim/omim.rfq.tfa
  60827320 residues in 85289 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 5.1091+/-0.000308; mu= 10.0958+/- 0.019
 mean_var=58.1434+/-11.630, 0's: 0 Z-trim(116.3): 2  B-trim: 116 in 2/56
 Lambda= 0.168199
 statistics sampled from 27306 (27308) to 27306 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.721), E-opt: 0.2 (0.32), width:  16
 Scan time:  3.780

The best scores are:                                      opt bits E(85289)
NP_000031 (OMIM: 107720,614028) apolipoprotein C-I (  99)  630 160.5 4.1e-40


>>NP_000031 (OMIM: 107720,614028) apolipoprotein C-III p  (99 aa)
 initn: 630 init1: 630 opt: 630  Z-score: 841.1  bits: 160.5 E(85289): 4.1e-40
Smith-Waterman score: 630; 100.0% identity (100.0% similar) in 99 aa overlap (1-99:1-99)

               10        20        30        40        50        60
pF1KE3 MQPRVLLVVALLALLASARASEAEDASLLSFMQGYMKHATKTAKDALSSVQESQVAQQAR
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
NP_000 MQPRVLLVVALLALLASARASEAEDASLLSFMQGYMKHATKTAKDALSSVQESQVAQQAR
               10        20        30        40        50        60

               70        80        90         
pF1KE3 GWVTDGFSSLKDYWSTVKDKFSEFWDLDPEVRPTSAVAA
       :::::::::::::::::::::::::::::::::::::::
NP_000 GWVTDGFSSLKDYWSTVKDKFSEFWDLDPEVRPTSAVAA
               70        80        90         




99 residues in 1 query   sequences
60827320 residues in 85289 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Mon Nov  7 00:21:54 2016 done: Mon Nov  7 00:21:55 2016
 Total Scan time:  3.780 Total Display time: -0.030

Function used was FASTA [36.3.4 Apr, 2011]
Inquiries or Suggestions ?
Send a message to flexiclone AT kazusagt.com