Result of FASTA (ccds) for pFN21AE3647
FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KE3647, 99 aa
  1>>>pF1KE3647 99 - 99 aa - 99 aa
Library: human.CCDS.faa
  18511270 residues in 32554 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 5.3001+/-0.000624; mu= 8.8609+/- 0.037
 mean_var=56.7273+/-11.292, 0's: 0 Z-trim(109.7): 5  B-trim: 0 in 0/55
 Lambda= 0.170286
 statistics sampled from 11094 (11097) to 11094 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.736), E-opt: 0.2 (0.341), width:  16
 Scan time:  1.560

The best scores are:                                      opt bits E(32554)
CCDS8377.1 APOC3 gene_id:345|Hs108|chr11           (  99)  630 162.3 4.6e-41


>>CCDS8377.1 APOC3 gene_id:345|Hs108|chr11                (99 aa)
 initn: 630 init1: 630 opt: 630  Z-score: 850.7  bits: 162.3 E(32554): 4.6e-41
Smith-Waterman score: 630; 100.0% identity (100.0% similar) in 99 aa overlap (1-99:1-99)

               10        20        30        40        50        60
pF1KE3 MQPRVLLVVALLALLASARASEAEDASLLSFMQGYMKHATKTAKDALSSVQESQVAQQAR
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS83 MQPRVLLVVALLALLASARASEAEDASLLSFMQGYMKHATKTAKDALSSVQESQVAQQAR
               10        20        30        40        50        60

               70        80        90         
pF1KE3 GWVTDGFSSLKDYWSTVKDKFSEFWDLDPEVRPTSAVAA
       :::::::::::::::::::::::::::::::::::::::
CCDS83 GWVTDGFSSLKDYWSTVKDKFSEFWDLDPEVRPTSAVAA
               70        80        90         




99 residues in 1 query   sequences
18511270 residues in 32554 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Mon Nov  7 00:21:53 2016 done: Mon Nov  7 00:21:54 2016
 Total Scan time:  1.560 Total Display time: -0.020

Function used was FASTA [36.3.4 Apr, 2011]
Inquiries or Suggestions ?
Send a message to flexiclone AT kazusagt.com