FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KE2211, 112 aa
  1>>>pF1KE2211 112 - 112 aa - 112 aa
Library: /omim/omim.rfq.tfa
  60827320 residues in 85289 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 6.7331+/-0.000259; mu= 5.9382+/- 0.016
 mean_var=127.4959+/-25.533, 0's: 0 Z-trim(123.6): 2  B-trim: 0 in 0/58
 Lambda= 0.113586
 statistics sampled from 43783 (43786) to 43783 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.828), E-opt: 0.2 (0.513), width:  16
 Scan time:  5.050

The best scores are:                                      opt bits E(85289)
NP_149976 (OMIM: 605902) urocortin-2 preproprotein ( 112)  751 132.3 1.6e-31


>>NP_149976 (OMIM: 605902) urocortin-2 preproprotein [Ho  (112 aa)
 initn: 751 init1: 751 opt: 751  Z-score: 686.9  bits: 132.3 E(85289): 1.6e-31
Smith-Waterman score: 751; 100.0% identity (100.0% similar) in 112 aa overlap (1-112:1-112)

               10        20        30        40        50        60
pF1KE2 MTRCALLLLMVLMLGRVLVVPVTPIPTFQLRPQNSPQTTPRPAASESPSAAPTWPWAAQS
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
NP_149 MTRCALLLLMVLMLGRVLVVPVTPIPTFQLRPQNSPQTTPRPAASESPSAAPTWPWAAQS
               10        20        30        40        50        60

               70        80        90       100       110  
pF1KE2 HCSPTRHPGSRIVLSLDVPIGLLQILLEQARARAAREQATTNARILARVGHC
       ::::::::::::::::::::::::::::::::::::::::::::::::::::
NP_149 HCSPTRHPGSRIVLSLDVPIGLLQILLEQARARAAREQATTNARILARVGHC
               70        80        90       100       110  




112 residues in 1 query   sequences
60827320 residues in 85289 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Mon Nov  7 00:41:14 2016 done: Mon Nov  7 00:41:14 2016
 Total Scan time:  5.050 Total Display time: -0.040

Function used was FASTA [36.3.4 Apr, 2011]