Result of FASTA (ccds) for pFN21AE2211
FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KE2211, 112 aa
  1>>>pF1KE2211 112 - 112 aa - 112 aa
Library: human.CCDS.faa
  18511270 residues in 32554 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 6.6295+/-0.000635; mu= 6.6687+/- 0.039
 mean_var=123.1416+/-24.248, 0's: 0 Z-trim(116.2): 3  B-trim: 0 in 0/51
 Lambda= 0.115577
 statistics sampled from 16819 (16822) to 16819 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.832), E-opt: 0.2 (0.517), width:  16
 Scan time:  1.710

The best scores are:                                      opt bits E(32554)
CCDS2772.1 UCN2 gene_id:90226|Hs108|chr3           ( 112)  751 134.3 1.5e-32


>>CCDS2772.1 UCN2 gene_id:90226|Hs108|chr3                (112 aa)
 initn: 751 init1: 751 opt: 751  Z-score: 697.7  bits: 134.3 E(32554): 1.5e-32
Smith-Waterman score: 751; 100.0% identity (100.0% similar) in 112 aa overlap (1-112:1-112)

               10        20        30        40        50        60
pF1KE2 MTRCALLLLMVLMLGRVLVVPVTPIPTFQLRPQNSPQTTPRPAASESPSAAPTWPWAAQS
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS27 MTRCALLLLMVLMLGRVLVVPVTPIPTFQLRPQNSPQTTPRPAASESPSAAPTWPWAAQS
               10        20        30        40        50        60

               70        80        90       100       110  
pF1KE2 HCSPTRHPGSRIVLSLDVPIGLLQILLEQARARAAREQATTNARILARVGHC
       ::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS27 HCSPTRHPGSRIVLSLDVPIGLLQILLEQARARAAREQATTNARILARVGHC
               70        80        90       100       110  




112 residues in 1 query   sequences
18511270 residues in 32554 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Mon Nov  7 00:41:13 2016 done: Mon Nov  7 00:41:13 2016
 Total Scan time:  1.710 Total Display time: -0.020

Function used was FASTA [36.3.4 Apr, 2011]
Inquiries or Suggestions ?
Send a message to flexiclone AT kazusagt.com