FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE5226, 176 aa 1>>>pF1KE5226 176 - 176 aa - 176 aa Library: human.CCDS.faa 18511270 residues in 32554 sequences Statistics: Expectation_n fit: rho(ln(x))= 5.4221+/-0.000766; mu= 11.3790+/- 0.046 mean_var=58.0582+/-11.782, 0's: 0 Z-trim(107.1): 13 B-trim: 50 in 1/49 Lambda= 0.168323 statistics sampled from 9386 (9389) to 9386 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.69), E-opt: 0.2 (0.288), width: 16 Scan time: 1.960 The best scores are: opt bits E(32554) CCDS1915.1 MCEE gene_id:84693|Hs108|chr2 ( 176) 1131 282.6 8.4e-77 >>CCDS1915.1 MCEE gene_id:84693|Hs108|chr2 (176 aa) initn: 1131 init1: 1131 opt: 1131 Z-score: 1492.3 bits: 282.6 E(32554): 8.4e-77 Smith-Waterman score: 1131; 99.4% identity (99.4% similar) in 176 aa overlap (1-176:1-176) 10 20 30 40 50 60 pF1KE5 MARVLKAAAANAVGLFSRLQAPIPTVRASSTSQPLDQVTGSVWNLGRLNHVAIAVPDLEK :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS19 MARVLKAAAANAVGLFSRLQAPIPTVRASSTSQPLDQVTGSVWNLGRLNHVAIAVPDLEK 10 20 30 40 50 60 70 80 90 100 110 120 pF1KE5 AAAFYKNILGAQVSEAVPLPEHGVSVVFVNLGNTKMELLHPLGLDSPIAGFLQKNKAGGM ::::::::::::::::::::::::::::::::::::::::::: :::::::::::::::: CCDS19 AAAFYKNILGAQVSEAVPLPEHGVSVVFVNLGNTKMELLHPLGRDSPIAGFLQKNKAGGM 70 80 90 100 110 120 130 140 150 160 170 pF1KE5 HHICIEVDNINAAVMDLKKKKIRSLSEEVKIGAHGKPVIFLHPKDCGGVLVELEQA :::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS19 HHICIEVDNINAAVMDLKKKKIRSLSEEVKIGAHGKPVIFLHPKDCGGVLVELEQA 130 140 150 160 170 176 residues in 1 query sequences 18511270 residues in 32554 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Mon Nov 7 22:41:11 2016 done: Mon Nov 7 22:41:11 2016 Total Scan time: 1.960 Total Display time: -0.010 Function used was FASTA [36.3.4 Apr, 2011]