Result of FASTA (ccds) for pFN21AE6105
FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KE6105, 82 aa
  1>>>pF1KE6105 82 - 82 aa - 82 aa
Library: human.CCDS.faa
  18511270 residues in 32554 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 4.9809+/-0.000581; mu= 8.5204+/- 0.035
 mean_var=42.5070+/- 8.644, 0's: 0 Z-trim(109.5): 11  B-trim: 56 in 1/49
 Lambda= 0.196718
 statistics sampled from 10925 (10927) to 10925 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.733), E-opt: 0.2 (0.336), width:  16
 Scan time:  1.060

The best scores are:                                      opt bits E(32554)
CCDS11933.1 IER3IP1 gene_id:51124|Hs108|chr18      (  82)  519 153.8 1.1e-38


>>CCDS11933.1 IER3IP1 gene_id:51124|Hs108|chr18           (82 aa)
 initn: 519 init1: 519 opt: 519  Z-score: 807.8  bits: 153.8 E(32554): 1.1e-38
Smith-Waterman score: 519; 100.0% identity (100.0% similar) in 82 aa overlap (1-82:1-82)

               10        20        30        40        50        60
pF1KE6 MAFTLYSLLQAALLCVNAIAVLHEERFLKNIGWGTDQGIGGFGEEPGIKSQLMNLIRSVR
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS11 MAFTLYSLLQAALLCVNAIAVLHEERFLKNIGWGTDQGIGGFGEEPGIKSQLMNLIRSVR
               10        20        30        40        50        60

               70        80  
pF1KE6 TVMRVPLIIVNSIAIVLLLLFG
       ::::::::::::::::::::::
CCDS11 TVMRVPLIIVNSIAIVLLLLFG
               70        80  




82 residues in 1 query   sequences
18511270 residues in 32554 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Tue Nov  8 09:29:53 2016 done: Tue Nov  8 09:29:53 2016
 Total Scan time:  1.060 Total Display time: -0.030

Function used was FASTA [36.3.4 Apr, 2011]
Inquiries or Suggestions ?
Send a message to flexiclone AT kazusagt.com