FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE6145, 90 aa 1>>>pF1KE6145 90 - 90 aa - 90 aa Library: /omim/omim.rfq.tfa 60827320 residues in 85289 sequences Statistics: Expectation_n fit: rho(ln(x))= 5.1233+/-0.00029; mu= 8.7612+/- 0.018 mean_var=52.3587+/-10.428, 0's: 0 Z-trim(116.9): 27 B-trim: 45 in 1/53 Lambda= 0.177247 statistics sampled from 28458 (28485) to 28458 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.731), E-opt: 0.2 (0.334), width: 16 Scan time: 3.690 The best scores are: opt bits E(85289) NP_006809 (OMIM: 604684,607785) protein AF1q [Homo ( 90) 596 159.7 5.9e-40 >>NP_006809 (OMIM: 604684,607785) protein AF1q [Homo sap (90 aa) initn: 596 init1: 596 opt: 596 Z-score: 838.2 bits: 159.7 E(85289): 5.9e-40 Smith-Waterman score: 596; 100.0% identity (100.0% similar) in 90 aa overlap (1-90:1-90) 10 20 30 40 50 60 pF1KE6 MRDPVSSQYSSFLFWRMPIPELDLSELEGLGLSDTATYKVKDSSVGKMIGQATAADQEKN :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_006 MRDPVSSQYSSFLFWRMPIPELDLSELEGLGLSDTATYKVKDSSVGKMIGQATAADQEKN 10 20 30 40 50 60 70 80 90 pF1KE6 PEGDGLLEYSTFNFWRAPIASIHSFELDLL :::::::::::::::::::::::::::::: NP_006 PEGDGLLEYSTFNFWRAPIASIHSFELDLL 70 80 90 90 residues in 1 query sequences 60827320 residues in 85289 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Tue Nov 8 09:50:48 2016 done: Tue Nov 8 09:50:49 2016 Total Scan time: 3.690 Total Display time: -0.010 Function used was FASTA [36.3.4 Apr, 2011]