Result of FASTA (omim) for pFN21AE6145
FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KE6145, 90 aa
  1>>>pF1KE6145 90 - 90 aa - 90 aa
Library: /omim/omim.rfq.tfa
  60827320 residues in 85289 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 5.1233+/-0.00029; mu= 8.7612+/- 0.018
 mean_var=52.3587+/-10.428, 0's: 0 Z-trim(116.9): 27  B-trim: 45 in 1/53
 Lambda= 0.177247
 statistics sampled from 28458 (28485) to 28458 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.731), E-opt: 0.2 (0.334), width:  16
 Scan time:  3.690

The best scores are:                                      opt bits E(85289)
NP_006809 (OMIM: 604684,607785) protein AF1q [Homo (  90)  596 159.7 5.9e-40


>>NP_006809 (OMIM: 604684,607785) protein AF1q [Homo sap  (90 aa)
 initn: 596 init1: 596 opt: 596  Z-score: 838.2  bits: 159.7 E(85289): 5.9e-40
Smith-Waterman score: 596; 100.0% identity (100.0% similar) in 90 aa overlap (1-90:1-90)

               10        20        30        40        50        60
pF1KE6 MRDPVSSQYSSFLFWRMPIPELDLSELEGLGLSDTATYKVKDSSVGKMIGQATAADQEKN
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
NP_006 MRDPVSSQYSSFLFWRMPIPELDLSELEGLGLSDTATYKVKDSSVGKMIGQATAADQEKN
               10        20        30        40        50        60

               70        80        90
pF1KE6 PEGDGLLEYSTFNFWRAPIASIHSFELDLL
       ::::::::::::::::::::::::::::::
NP_006 PEGDGLLEYSTFNFWRAPIASIHSFELDLL
               70        80        90




90 residues in 1 query   sequences
60827320 residues in 85289 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Tue Nov  8 09:50:48 2016 done: Tue Nov  8 09:50:49 2016
 Total Scan time:  3.690 Total Display time: -0.010

Function used was FASTA [36.3.4 Apr, 2011]
Inquiries or Suggestions ?
Send a message to flexiclone AT kazusagt.com