Result of FASTA (omim) for pFN21AE5120
FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KE5120, 103 aa
  1>>>pF1KE5120 103 - 103 aa - 103 aa
Library: /omim/omim.rfq.tfa
  60827320 residues in 85289 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 5.5889+/-0.000267; mu= 9.3031+/- 0.017
 mean_var=81.7643+/-15.778, 0's: 0 Z-trim(121.0): 11  B-trim: 93 in 1/53
 Lambda= 0.141838
 statistics sampled from 36889 (36901) to 36889 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.789), E-opt: 0.2 (0.433), width:  16
 Scan time:  3.890

The best scores are:                                      opt bits E(85289)
NP_036465 (OMIM: 606535) C-Myc-binding protein [Ho ( 103)  653 141.8 1.8e-34


>>NP_036465 (OMIM: 606535) C-Myc-binding protein [Homo s  (103 aa)
 initn: 653 init1: 653 opt: 653  Z-score: 739.8  bits: 141.8 E(85289): 1.8e-34
Smith-Waterman score: 653; 100.0% identity (100.0% similar) in 103 aa overlap (1-103:1-103)

               10        20        30        40        50        60
pF1KE5 MAHYKAADSKREQFRRYLEKSGVLDTLTKVLVALYEEPEKPNSALDFLKHHLGAATPENP
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
NP_036 MAHYKAADSKREQFRRYLEKSGVLDTLTKVLVALYEEPEKPNSALDFLKHHLGAATPENP
               10        20        30        40        50        60

               70        80        90       100   
pF1KE5 EIELLRLELAEMKEKYEAIVEENKKLKAKLAQYEPPQEEKRAE
       :::::::::::::::::::::::::::::::::::::::::::
NP_036 EIELLRLELAEMKEKYEAIVEENKKLKAKLAQYEPPQEEKRAE
               70        80        90       100   




103 residues in 1 query   sequences
60827320 residues in 85289 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Mon Nov  7 21:36:15 2016 done: Mon Nov  7 21:36:16 2016
 Total Scan time:  3.890 Total Display time: -0.020

Function used was FASTA [36.3.4 Apr, 2011]
Inquiries or Suggestions ?
Send a message to flexiclone AT kazusagt.com