Result of FASTA (ccds) for pFN21AE5120
FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KE5120, 103 aa
  1>>>pF1KE5120 103 - 103 aa - 103 aa
Library: human.CCDS.faa
  18511270 residues in 32554 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 5.4583+/-0.000603; mu= 10.0664+/- 0.037
 mean_var=78.0301+/-15.188, 0's: 0 Z-trim(113.4): 7  B-trim: 18 in 1/51
 Lambda= 0.145192
 statistics sampled from 14014 (14019) to 14014 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.792), E-opt: 0.2 (0.431), width:  16
 Scan time:  1.250

The best scores are:                                      opt bits E(32554)
CCDS431.1 MYCBP gene_id:26292|Hs108|chr1           ( 103)  653 144.8 8.9e-36


>>CCDS431.1 MYCBP gene_id:26292|Hs108|chr1                (103 aa)
 initn: 653 init1: 653 opt: 653  Z-score: 755.8  bits: 144.8 E(32554): 8.9e-36
Smith-Waterman score: 653; 100.0% identity (100.0% similar) in 103 aa overlap (1-103:1-103)

               10        20        30        40        50        60
pF1KE5 MAHYKAADSKREQFRRYLEKSGVLDTLTKVLVALYEEPEKPNSALDFLKHHLGAATPENP
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS43 MAHYKAADSKREQFRRYLEKSGVLDTLTKVLVALYEEPEKPNSALDFLKHHLGAATPENP
               10        20        30        40        50        60

               70        80        90       100   
pF1KE5 EIELLRLELAEMKEKYEAIVEENKKLKAKLAQYEPPQEEKRAE
       :::::::::::::::::::::::::::::::::::::::::::
CCDS43 EIELLRLELAEMKEKYEAIVEENKKLKAKLAQYEPPQEEKRAE
               70        80        90       100   




103 residues in 1 query   sequences
18511270 residues in 32554 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Mon Nov  7 21:36:15 2016 done: Mon Nov  7 21:36:15 2016
 Total Scan time:  1.250 Total Display time: -0.030

Function used was FASTA [36.3.4 Apr, 2011]
Inquiries or Suggestions ?
Send a message to flexiclone AT kazusagt.com