Result of FASTA (ccds) for pFN21AE1393
FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KE1393, 93 aa
  1>>>pF1KE1393 93 - 93 aa - 93 aa
Library: human.CCDS.faa
  18511270 residues in 32554 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 5.0547+/-0.000797; mu= 9.4780+/- 0.048
 mean_var=62.6114+/-12.904, 0's: 0 Z-trim(107.3): 37  B-trim: 393 in 1/47
 Lambda= 0.162087
 statistics sampled from 9456 (9491) to 9456 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.694), E-opt: 0.2 (0.292), width:  16
 Scan time:  1.200

The best scores are:                                      opt bits E(32554)
CCDS1038.1 S100A8 gene_id:6279|Hs108|chr1          (  93)  608 150.3 1.6e-37


>>CCDS1038.1 S100A8 gene_id:6279|Hs108|chr1               (93 aa)
 initn: 608 init1: 608 opt: 608  Z-score: 787.1  bits: 150.3 E(32554): 1.6e-37
Smith-Waterman score: 608; 100.0% identity (100.0% similar) in 93 aa overlap (1-93:1-93)

               10        20        30        40        50        60
pF1KE1 MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDI
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS10 MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDI
               10        20        30        40        50        60

               70        80        90   
pF1KE1 NTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE
       :::::::::::::::::::::::::::::::::
CCDS10 NTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE
               70        80        90   




93 residues in 1 query   sequences
18511270 residues in 32554 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Mon Nov  7 02:19:33 2016 done: Mon Nov  7 02:19:34 2016
 Total Scan time:  1.200 Total Display time: -0.020

Function used was FASTA [36.3.4 Apr, 2011]
Inquiries or Suggestions ?
Send a message to flexiclone AT kazusagt.com