Result of FASTA (ccds) for pFN21AE6132
FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KE6132, 114 aa
  1>>>pF1KE6132 114 - 114 aa - 114 aa
Library: human.CCDS.faa
  18511270 residues in 32554 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 4.6940+/-0.000724; mu= 13.8788+/- 0.043
 mean_var=73.1309+/-13.922, 0's: 0 Z-trim(109.8): 14  B-trim: 45 in 1/50
 Lambda= 0.149977
 statistics sampled from 11108 (11115) to 11108 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.736), E-opt: 0.2 (0.341), width:  16
 Scan time:  1.210

The best scores are:                                      opt bits E(32554)
CCDS73096.1 MSMB gene_id:4477|Hs108|chr10          ( 114)  813 184.1 1.6e-47


>>CCDS73096.1 MSMB gene_id:4477|Hs108|chr10               (114 aa)
 initn: 813 init1: 813 opt: 813  Z-score: 966.8  bits: 184.1 E(32554): 1.6e-47
Smith-Waterman score: 813; 100.0% identity (100.0% similar) in 114 aa overlap (1-114:1-114)

               10        20        30        40        50        60
pF1KE6 MNVLLGSVVIFATFVTLCNASCYFIPNEGVPGDSTRKCMDLKGNKHPINSEWQTDNCETC
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS73 MNVLLGSVVIFATFVTLCNASCYFIPNEGVPGDSTRKCMDLKGNKHPINSEWQTDNCETC
               10        20        30        40        50        60

               70        80        90       100       110    
pF1KE6 TCYETEISCCTLVSTPVGYDKDNCQRIFKKEDCKYIVVEKKDPKKTCSVSEWII
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS73 TCYETEISCCTLVSTPVGYDKDNCQRIFKKEDCKYIVVEKKDPKKTCSVSEWII
               70        80        90       100       110    




114 residues in 1 query   sequences
18511270 residues in 32554 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Tue Nov  8 09:44:18 2016 done: Tue Nov  8 09:44:18 2016
 Total Scan time:  1.210 Total Display time: -0.030

Function used was FASTA [36.3.4 Apr, 2011]
Inquiries or Suggestions ?
Send a message to flexiclone AT kazusagt.com