Result of FASTA (ccds) for pFN21AE5114
FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KE5114, 118 aa
  1>>>pF1KE5114 118 - 118 aa - 118 aa
Library: human.CCDS.faa
  18511270 residues in 32554 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 5.0238+/-0.000525; mu= 13.1172+/- 0.032
 mean_var=73.0006+/-14.291, 0's: 0 Z-trim(115.1): 11  B-trim: 98 in 1/51
 Lambda= 0.150110
 statistics sampled from 15700 (15705) to 15700 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.823), E-opt: 0.2 (0.482), width:  16
 Scan time:  1.490

The best scores are:                                      opt bits E(32554)
CCDS10321.1 FAM103A1 gene_id:83640|Hs108|chr15     ( 118)  889 200.1 2.6e-52


>>CCDS10321.1 FAM103A1 gene_id:83640|Hs108|chr15          (118 aa)
 initn: 889 init1: 889 opt: 889  Z-score: 1052.8  bits: 200.1 E(32554): 2.6e-52
Smith-Waterman score: 889; 100.0% identity (100.0% similar) in 118 aa overlap (1-118:1-118)

               10        20        30        40        50        60
pF1KE5 MTDTAEAVPKFEEMFASRFTENDKEYQEYLKRPPESPPIVEEWNSRAGGNQRNRGNRLQD
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS10 MTDTAEAVPKFEEMFASRFTENDKEYQEYLKRPPESPPIVEEWNSRAGGNQRNRGNRLQD
               10        20        30        40        50        60

               70        80        90       100       110        
pF1KE5 NRQFRGRDNRWGWPSDNRSNQWHGRSWGNNYPQHRQEPYYPQQYGHYGYNQRPPYGYY
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS10 NRQFRGRDNRWGWPSDNRSNQWHGRSWGNNYPQHRQEPYYPQQYGHYGYNQRPPYGYY
               70        80        90       100       110        




118 residues in 1 query   sequences
18511270 residues in 32554 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Mon Nov  7 21:28:29 2016 done: Mon Nov  7 21:28:29 2016
 Total Scan time:  1.490 Total Display time: -0.040

Function used was FASTA [36.3.4 Apr, 2011]
Inquiries or Suggestions ?
Send a message to flexiclone AT kazusagt.com