FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE1439, 129 aa 1>>>pF1KE1439 129 - 129 aa - 129 aa Library: /omim/omim.rfq.tfa 60827320 residues in 85289 sequences Statistics: Expectation_n fit: rho(ln(x))= 4.7016+/-0.000254; mu= 15.3410+/- 0.016 mean_var=75.8640+/-14.789, 0's: 0 Z-trim(122.2): 4 B-trim: 30 in 1/55 Lambda= 0.147250 statistics sampled from 40055 (40062) to 40055 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.813), E-opt: 0.2 (0.47), width: 16 Scan time: 5.190 The best scores are: opt bits E(85289) NP_057723 (OMIM: 605914) tumor necrosis factor rec ( 129) 908 200.7 5.3e-52 >>NP_057723 (OMIM: 605914) tumor necrosis factor recepto (129 aa) initn: 908 init1: 908 opt: 908 Z-score: 1054.5 bits: 200.7 E(85289): 5.3e-52 Smith-Waterman score: 908; 100.0% identity (100.0% similar) in 129 aa overlap (1-129:1-129) 10 20 30 40 50 60 pF1KE1 MARGSLRRLLRLLVLGLWLALLRSVAGEQAPGTAPCSRGSSWSADLDKCMDCASCRARPH :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_057 MARGSLRRLLRLLVLGLWLALLRSVAGEQAPGTAPCSRGSSWSADLDKCMDCASCRARPH 10 20 30 40 50 60 70 80 90 100 110 120 pF1KE1 SDFCLGCAAAPPAPFRLLWPILGGALSLTFVLGLLSGFLVWRRCRRREKFTTPIEETGGE :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_057 SDFCLGCAAAPPAPFRLLWPILGGALSLTFVLGLLSGFLVWRRCRRREKFTTPIEETGGE 70 80 90 100 110 120 pF1KE1 GCPAVALIQ ::::::::: NP_057 GCPAVALIQ 129 residues in 1 query sequences 60827320 residues in 85289 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Mon Nov 7 02:35:50 2016 done: Mon Nov 7 02:35:51 2016 Total Scan time: 5.190 Total Display time: -0.040 Function used was FASTA [36.3.4 Apr, 2011]