FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KE5105, 115 aa
  1>>>pF1KE5105 115 - 115 aa - 115 aa
Library: /omim/omim.rfq.tfa
  60827320 residues in 85289 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 5.8445+/-0.000244; mu= 9.9986+/- 0.015
 mean_var=93.5575+/-18.856, 0's: 0 Z-trim(123.5): 1  B-trim: 2394 in 1/56
 Lambda= 0.132597
 statistics sampled from 43438 (43439) to 43438 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.822), E-opt: 0.2 (0.509), width:  16
 Scan time:  3.990

The best scores are:                                      opt bits E(85289)
NP_001020 (OMIM: 603701,613309) 40S ribosomal prot ( 115)  796 160.6 5.3e-40


>>NP_001020 (OMIM: 603701,613309) 40S ribosomal protein   (115 aa)
 initn: 796 init1: 796 opt: 796  Z-score: 839.2  bits: 160.6 E(85289): 5.3e-40
Smith-Waterman score: 796; 100.0% identity (100.0% similar) in 115 aa overlap (1-115:1-115)

               10        20        30        40        50        60
pF1KE5 MTKKRRNNGRAKKGRGHVQPIRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDISEASVFD
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
NP_001 MTKKRRNNGRAKKGRGHVQPIRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDISEASVFD
               10        20        30        40        50        60

               70        80        90       100       110     
pF1KE5 AYVLPKLYVKLHYCVSCAIHSKVVRNRSREARKDRTPPPRFRPAGAAPRPPPKPM
       :::::::::::::::::::::::::::::::::::::::::::::::::::::::
NP_001 AYVLPKLYVKLHYCVSCAIHSKVVRNRSREARKDRTPPPRFRPAGAAPRPPPKPM
               70        80        90       100       110     




115 residues in 1 query   sequences
60827320 residues in 85289 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Mon Nov  7 21:07:26 2016 done: Mon Nov  7 21:07:27 2016
 Total Scan time:  3.990 Total Display time: -0.020

Function used was FASTA [36.3.4 Apr, 2011]