FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE6160, 116 aa 1>>>pF1KE6160 116 - 116 aa - 116 aa Library: /omim/omim.rfq.tfa 60827320 residues in 85289 sequences Statistics: Expectation_n fit: rho(ln(x))= 4.9659+/-0.000231; mu= 12.9707+/- 0.015 mean_var=64.5750+/-12.747, 0's: 0 Z-trim(123.4): 4 B-trim: 0 in 0/55 Lambda= 0.159603 statistics sampled from 43108 (43114) to 43108 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.846), E-opt: 0.2 (0.506), width: 16 Scan time: 4.280 The best scores are: opt bits E(85289) NP_149097 (OMIM: 611178) galanin-like peptide isof ( 116) 779 186.5 8.4e-48 NP_001139018 (OMIM: 611178) galanin-like peptide i ( 49) 180 48.3 1.4e-06 NP_057057 (OMIM: 137035,616461) galanin peptides p ( 123) 134 38.0 0.0045 >>NP_149097 (OMIM: 611178) galanin-like peptide isoform (116 aa) initn: 779 init1: 779 opt: 779 Z-score: 979.2 bits: 186.5 E(85289): 8.4e-48 Smith-Waterman score: 779; 100.0% identity (100.0% similar) in 116 aa overlap (1-116:1-116) 10 20 30 40 50 60 pF1KE6 MAPPSVPLVLLLVLLLSLAETPASAPAHRGRGGWTLNSAGYLLGPVLHLPQMGDQDGKRE :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_149 MAPPSVPLVLLLVLLLSLAETPASAPAHRGRGGWTLNSAGYLLGPVLHLPQMGDQDGKRE 10 20 30 40 50 60 70 80 90 100 110 pF1KE6 TALEILDLWKAIDGLPYSHPPQPSKRNVMETFAKPEIGDLGMLSMKIPKEEDVLKS :::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_149 TALEILDLWKAIDGLPYSHPPQPSKRNVMETFAKPEIGDLGMLSMKIPKEEDVLKS 70 80 90 100 110 >>NP_001139018 (OMIM: 611178) galanin-like peptide isofo (49 aa) initn: 180 init1: 180 opt: 180 Z-score: 239.1 bits: 48.3 E(85289): 1.4e-06 Smith-Waterman score: 180; 100.0% identity (100.0% similar) in 29 aa overlap (1-29:1-29) 10 20 30 40 50 60 pF1KE6 MAPPSVPLVLLLVLLLSLAETPASAPAHRGRGGWTLNSAGYLLGPVLHLPQMGDQDGKRE ::::::::::::::::::::::::::::: NP_001 MAPPSVPLVLLLVLLLSLAETPASAPAHRSSTFPKWVTKTERGRQPLRS 10 20 30 40 >>NP_057057 (OMIM: 137035,616461) galanin peptides prepr (123 aa) initn: 132 init1: 94 opt: 134 Z-score: 176.2 bits: 38.0 E(85289): 0.0045 Smith-Waterman score: 134; 36.4% identity (58.7% similar) in 121 aa overlap (10-116:7-123) 10 20 30 40 50 pF1KE6 MAPPSVPLVLLLVLLLSLAETPASA----PAHRGRGGWTLNSAGYLLGP--VLHLPQMGD :::. :: : ::: ::.. :: :::::::::::: : . ...: NP_057 MARGSALLLASLLLAAALSASAGLWSPAKEKRG-WTLNSAGYLLGPHAVGNHRSFSD 10 20 30 40 50 60 70 80 90 100 pF1KE6 QDG---KRETALEILDLWKAIDGLPYSHPPQPSKRNVMETFAKPEIGDLGMLS--MKIP- ..: ::: :. : : .. : : . :...: .. .. . : :. . .: NP_057 KNGLTSKRE--LRPEDDMKP-GSFDRSIPENNIMRTIIEFLSFLHLKEAGALDRLLDLPA 60 70 80 90 100 110 110 pF1KE6 --KEEDVLKS . ::. .: NP_057 AASSEDIERS 120 116 residues in 1 query sequences 60827320 residues in 85289 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Tue Nov 8 09:58:23 2016 done: Tue Nov 8 09:58:24 2016 Total Scan time: 4.280 Total Display time: -0.040 Function used was FASTA [36.3.4 Apr, 2011]