FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448
Query: pF1KE6593, 51 aa
1>>>pF1KE6593 51 - 51 aa - 51 aa
Library: human.CCDS.faa
18511270 residues in 32554 sequences
Statistics: Expectation_n fit: rho(ln(x))= 3.8837+/-0.000557; mu= 11.0532+/- 0.033
mean_var=35.0569+/- 7.007, 0's: 0 Z-trim(109.9): 4 B-trim: 70 in 1/49
Lambda= 0.216614
statistics sampled from 11204 (11206) to 11204 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
ktup: 2, E-join: 1 (0.772), E-opt: 0.2 (0.344), width: 16
Scan time: 0.970
The best scores are: opt bits E(32554)
CCDS13476.1 ATP5E gene_id:514|Hs108|chr20 ( 51) 321 105.8 1.2e-24
>>CCDS13476.1 ATP5E gene_id:514|Hs108|chr20 (51 aa)
initn: 321 init1: 321 opt: 321 Z-score: 556.0 bits: 105.8 E(32554): 1.2e-24
Smith-Waterman score: 321; 100.0% identity (100.0% similar) in 51 aa overlap (1-51:1-51)
10 20 30 40 50
pF1KE6 MVAYWRQAGLSYIRYSQICAKAVRDALKTEFKANAEKTSGSNVKIVKVKKE
:::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS13 MVAYWRQAGLSYIRYSQICAKAVRDALKTEFKANAEKTSGSNVKIVKVKKE
10 20 30 40 50
51 residues in 1 query sequences
18511270 residues in 32554 library sequences
Tcomplib [36.3.4 Apr, 2011] (8 proc)
start: Tue Nov 8 14:39:12 2016 done: Tue Nov 8 14:39:13 2016
Total Scan time: 0.970 Total Display time: -0.030
Function used was FASTA [36.3.4 Apr, 2011]